Wasabi Receptor Toxin TFA  (Synonyms: WaTx TFA)

Wasabi Receptor Toxin TFA (WaTx TFA) is the TFA salt form of Wasabi Receptor Toxin (HY-P5914). Wasabi Receptor Toxin TFA is a cell-penetrating scorpion toxin. Wasabi Receptor Toxin TFA is the activator for TRPA1 ion channel with EC₅₀ in nanomolar level, and prolongs the channel open time, but reduces Ca²⁺ permeability. Wasabi Receptor Toxin TFA causes thermal hypersensitivity and mechanical allodynia in rats, without triggering neurogenic inflammation^[1].

3855.29 (free base)

C₁₆₄H₂₄₅N₄₅O₅₃S₅.xC₂HF₃O₂

Solid

White to off-white

Ala-Ser-Pro-Gln-Gln-Ala-Lys-Tyr-Cys-Tyr-Glu-Gln-Cys-Asn-Val-Asn-Lys-Val-Pro-Phe-Asp-Gln-Cys-Tyr-Gln-Met-Cys-Ser-Pro-Leu-Glu-Arg-Ser (Disulfide bridge: Cys9-Cys27; Cys13-Cys23)

ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS (Disulfide bridge: Cys9-Cys27; Cys13-Cys23)

O=C([C@@H](N)C)N[C@H](C(N1[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N2[C@H](C(N[C@H](C(N[C@H](C(N[C@H]3CCC(N)=O)=O)CC(O)=O)=O)CC4=CC=CC=C4)=O)CCC2)=O)C(C)C)=O)CCCCN)=O)CC(N)=O)=O)C(C)C)=O)CC(N)=O)=O)CSSCC(NC3=O)C(N[C@H](C(N[C@H](C(N[C@H]5CCSC)=O)CCC(N)=O)=O)CC6=CC=C(O)C=C6)=O)=O)CCC(N)=O)=O)CCC(O)=O)=O)CC7=CC=C(O)C=C7)=O)CSSC[C@H](NC5=O)C(N[C@H](C(N8[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(O)=O)CO)=O)CCCNC(N)=N)=O)CCC(O)=O)=O)CC(C)C)=O)CCC8)=O)CO)=O)=O)CC9=CC=C(O)C=C9)=O)CCCCN)=O)C)=O)CCC(N)=O)=O)CCC(N)=O)=O)CCC1)=O)CO.OC(C(F)(F)F)=O.[x]

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

• [1]. John V Lin King, et al. A Cell-Penetrating Scorpion Toxin Enables Mode-Specific Modulation of TRPA1 and Pain. Cell. 2019, 178,6.  [Content Brief]