β-Amyloid (1-40) (rat)

Name: β-Amyloid (1-40) (rat)
Brand: MedChemExpress
SKU: HY-P1387
Rating: 4.5 (1 reviews)

Cat. No.: HY-P1387 Purity: 95.13%: FAQs
Data Sheet SDS COA Handling Instructions

Molarity Calculator

β-Amyloid (1-40) (rat) is a rat form of the amyloid β-peptide, which accumulates as an insoluble extracellular deposit around neurons, giving rise to the senile plaques associated with Alzheimer's disease (AD). β-Amyloid (1-40) (rat) increases ⁴⁵Ca²⁺ influx, induces neurodegeneration in the rat hippocampal neurons of the CA1 subfield. β-Amyloid (1-40) (rat) induces apoptosis. β-Amyloid (1-40) (rat) can be used for the research of Alzheimer's disease.

For research use only. We do not sell to patients.

β-Amyloid (1-40) (rat) Chemical Structure

CAS No. : 144409-98-3

Size	Price	Stock	Quantity
1 mg	USD 200	In-stock	Estimated Time of Arrival: December 31
5 mg		Get quote
10 mg		Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

1 Publications Citing Use of MCE β-Amyloid (1-40) (rat)

•Sci Rep. 2023 Aug 21;13(1):13586. [Abstract]

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

In Vitro

β-Amyloid (1-40) (rat) (1 μM; 1 h) increases ⁴⁵Ca²⁺ influx and elevates Ca²⁺ in cortical synaptosomes^[1].
β-Amyloid (1-40) (rat) (3 nM) induces neurodegeneration in the rat hippocampal neurons of the CA1 subfield and induces apoptosis^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

β-Amyloid (1-40) (rat) (1.7 mg; ICV, for 7 d; swiss and C57BL/6 mice) induces the learning and memory deficits in mice^[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:	Swiss and C57BL/6 mice^[3]
Dosage:	1.7 mg
Administration:	Intracerebroventrical injection; for 7 days
Result:	Presented spatial learning and memory impairments.

Molecular Weight

4233.76

Formula

C₁₉₀H₂₉₁N₅₁O₅₇S

CAS No.

144409-98-3

Appearance

Solid

Color

White to off-white

Sequence

Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

Sequence Shortening

DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV

SMILES

[DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV]

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder	-80°C	2 years
	-20°C	1 year

*The compound is unstable in solutions, freshly prepared is recommended.

Purity & Documentation

Purity: 95.13%

Select Batch:

Data Sheet (265 KB) SDS (252 KB)

COA (243 KB) RP-HPLC (164 KB) MS (241 KB)

Handling Instructions (2659 KB)

References

[1]. MacManus A, et, al. Enhancement of (45)Ca(2+) influx and voltage-dependent Ca(2+) channel activity by beta-amyloid-(1-40) in rat cortical synaptosomes and cultured cortical neurons. Modulation by the proinflammatory cytokine interleukin-1beta. J Biol Chem [Content Brief]

[2]. Miguel-Hidalgo JJ, et, al. Beta-amyloid(1-40)-induced neurodegeneration in the rat hippocampal neurons of the CA1 subfield. Acta Neuropathol. 1998 May;95(5):455-65. [Content Brief]

[3]. Prediger RD, et, al. Differential susceptibility following beta-amyloid peptide-(1-40) administration in C57BL/6 and Swiss albino mice: Evidence for a dissociation between cognitive deficits and the glutathione system response. Behav Brain Res. 2007 Feb 2 [Content Brief]