Adrenocorticotropic hormone TFA (Synonyms: ACTH TFA; Adrenocorticotrophic hormone TFA)

Cat. No.: HY-106373A Purity: 99.40%: Data Sheet
SDS

COA
Handling Instructions Technical Support

Solubility

In Vivo Dissolution Calculator

Adrenocorticotropic hormone (ACTH) TFA is a polypeptide tropic hormone produced by the anterior pituitary gland. Adrenocorticotropic hormone regulates cortisol and androgen production.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Adrenocorticotropic hormone TFA Chemical Structure

Size	Price	Stock	Quantity
5 mg	USD 168	In-stock	Estimated Time of Arrival: May 13
10 mg	USD 273	In-stock	Estimated Time of Arrival: May 13
25 mg	USD 578	In-stock	Estimated Time of Arrival: May 13
50 mg	USD 893	In-stock	Estimated Time of Arrival: May 13
100 mg		Get quote
200 mg		Get quote

Get it by May 13 for select sizes. Order within 22 hrs 3 mins.

or Bulk Inquiry

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Adrenocorticotropic hormone TFA:

Adrenocorticotropic hormone Get quote

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

Adrenocorticotropic hormone (ACTH) TFA is a polypeptide tropic hormone produced by the anterior pituitary gland. Adrenocorticotropic hormone regulates cortisol and androgen production^[1]^[2].

Clinical Trial

NCT Number	Sponsor	Condition	Start Date	Phase
NCT01838174	University of Colorado, Denver\|Mallinckrodt\|University of Pennsylvania	Multiple Sclerosis	May 2013	Phase 4
NCT02931175	Quan Dong Nguyen\|Mallinckrodt\|Ocular Imaging Research and Reading Center	Uveitis	January 2017	Phase 2
NCT00805753	Mayo Clinic\|Mallinckrodt	Idiopathic Membranous Nephropathy	January 2009	Phase 1
NCT03709381	Nationwide Children´s Hospital	Adrenal Insufficiency\|Osteopenia, Osteoporosis\|Steroid Suppression of ACTH Secretion	October 1, 2017	Early Phase 1
NCT03655509	Rennes University Hospital	Subarachnoid Hemorrhage	June 2013	Not Applicable
NCT02315872	Providence Health & Services\|Mallinckrodt	Multiple Sclerosis, Relapsing-Remitting	May 22, 2015	Phase 3
NCT05279118	All India Institute of Medical Sciences, New Delhi	Ketogenic Diet\|West Syndrome\|Infantile Spasm\|ACTH	March 1, 2022	Phase 2\|Phase 3
NCT04422756	University of Calgary\|Canadian Institutes of Health Research (CIHR)\|Hypertension Canada	Primary Aldosteronism	January 15, 2017
NCT03465111	Metropolitan Eye Research & Surgery Institute\|Mallinckrodt\|Stanford University\|Ocular Imaging Research and Reading Center\|Foresight Studies, LLC	Scleritis	January 1, 2019	Phase 2
NCT01428336	The Cleveland Clinic	Adrenal Insufficiency	September 2011	Not Applicable
NCT01906372	Rohit Aggarwal, MD\|Mallinckrodt\|University of Pittsburgh	Dermatomyositis\|Polymyositis	September 2013	Phase 2
NCT01950234	University of Minnesota\|Mallinckrodt	Secondary Progressive Multiple Sclerosis\|Primary Progressive Multiple Sclerosis\|Progressive Relapsing Multiple Sclerosis	April 17, 2014	Phase 2
NCT00950781	Cedars-Sinai Medical Center	Menopause	January 2009
NCT02092883	Wayne State University	Infantile Spasms	March 2013	Phase 4
NCT02155803	Albany Medical College	Sarcoidosis\|Hypercalcemia Due to Sarcoidosis	February 2015	Phase 2\|Phase 3
NCT04808856	Shanghai 10th People´s Hospital	Gout	April 1, 2021	Not Applicable
NCT02132195	Emory University\|Mallinckrodt	Nephrotic Syndrome	May 2014	Phase 3
NCT02413944	Bnai Zion Medical Center	Healthy	April 2015	Phase 4
NCT02972346	Xinhua Hospital, Shanghai Jiao Tong University School of Medicine	Proteinuria	November 2016	Not Applicable
NCT01028287	Southeast Renal Research Institute\|Mallinckrodt	Diabetic Nephropathy\|Nephrotic Syndrome	May 2009	Phase 4
NCT03905603	University of Virginia	Polycystic Ovary Syndrome	October 8, 2019	Early Phase 1
NCT01093157	University Health Network, Toronto\|Mallinckrodt	Glomerulonephritis	February 2010	Phase 1\|Phase 2
NCT02368379	Nationwide Children´s Hospital	Prader Willi Syndrome\|Adrenal Insufficiency	March 2014	Not Applicable
NCT01049451	University of Southern California	Multiple Sclerosis	November 2009	Phase 1
NCT02282930	Mayo Clinic\|Mallinckrodt	Progressive IgA Nephropathy\|Proteinuria	March 2015	Phase 3
NCT04306653	University of Patras	Gout Attack	January 5, 2018	Not Applicable
NCT03727776	Johns Hopkins University\|Mallinckrodt	Proliferative Vitreoretinopathy	August 19, 2019	Early Phase 1
NCT02290444	State University of New York at Buffalo	Multiple Sclerosis	August 2013	Phase 3
NCT02446886	Weill Medical College of Cornell University\|Mallinckrodt	Multiple Sclerosis	June 2016	Phase 4
NCT04461535	Chongqing Medical University	Primary Aldosteronism	July 8, 2020	Not Applicable
NCT00947895	Neurologique Foundation, Inc.\|Mallinckrodt	Multiple Sclerosis	October 2009	Phase 2\|Phase 3
NCT02501486	Radboud University Medical Center\|AIDS Fonds\|OLVG	Adrenal Insufficiency	July 2015	Not Applicable

Molecular Weight

4541.14 (free base)

Formula

C₂₀₇H₃₀₈N₅₆O₅₈S.xC₂HF₃O₂

Appearance

Solid

Color

White to off-white

Sequence

Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe

Sequence Shortening

SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility

In Vitro:

H₂O : 50 mg/mL (Need ultrasonic)

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Purity & Documentation

Purity: 99.40%

Select Batch:

Data Sheet (265 KB) SDS (252 KB)

COA (241 KB)

Handling Instructions (2659 KB)

References

[1]. Houngbadji MSTS, et al. Syndrome de résistance à l’Adrénocorticotrophine Hormone (ACTH): à propos d’un cas [Adrenocorticotropic hormone (ACTH) insensitivity syndrome: about a case]. Pan Afr Med J. 2018 Aug 2;30:244. French. [Content Brief]

[2]. Campbell I, et al. The effect of adrenocorticotrophic hormone on the yield, composition and butterfat properties of cow's milk. Journal of Dairy Research. 1964, 31(1), 71-79.

Adrenocorticotropic hormone TFA Related Classifications

Metabolic Disease

Keywords:

Adrenocorticotropic hormoneACTHAdrenocorticotrophic hormoneAndrogen ReceptorPolypeptidehormonecortisolandrogenInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Requested Quantity *

Applicant Name *

Salutation

Email Address *

Phone Number *

Department

Organization Name *

City

State

Country or Region *

Remarks

Product Name

Lot #

Applicant Name *

Email Address *

Phone Number

Department *

Organization Name *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.

Adrenocorticotropic hormone TFA (Synonyms: ACTH TFA; Adrenocorticotrophic hormone TFA)

Customer Review

Other Forms of Adrenocorticotropic hormone TFA:

Adrenocorticotropic hormone TFA Related Antibodies

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity

Purity & Documentation

References

Customer Review

Molarity Calculator

Dilution Calculator

Adrenocorticotropic hormone TFA Related Classifications

Keywords:

Your Recently Viewed Products:

Customer Review

Request for HNMR Report

SAFETY DATA SHEET (SDS)

Request for HNMR Report