ANGPTL3/Angiopoietin-like 3 Protein, Human (HEK293, His)

ANGPTL3/Angiopoietin-like 3 Protein, Human (HEK293, His) plays an important role in lipoprotein metabolism.Angiopoietin-like Protein 3 acts as a dual inhibitor of lipoprotein lipase (LPL) and endothelial lipase (EL).Angiopoietin-like Protein 3 inhibits endothelial lipase hydrolysis of HDL-phospholipid (PL), thereby increasing HDL-PL levels.

Angiopoietin-like proteins (ANGPTLs) represent a family of eight secreted glycoproteins that show structural homology to angiopoietins and carry distinct physiological functions, including putative roles in lipid metabolism, expansion of stem cells, inflammation, tissue remodeling and angiogenesis. In recent years, three ANGPTLs, ANGPTL3, ANGPTL4 and ANGP-TL8, have been shown to play a role in lipid metabolism and in the regulation of plasma lipid levels. The discovery of ANGPTL3 deficiency in mice and humans has stimulated a series of studies which have clarified the role of ANGPTL3 in lipoprotein metabolism. These investigations have suggested that ANGPTL3 may be a novel therapeutic target in the management of dyslipidemias in humans. The results of recent intervention trials aimed at inhibiting ANGPTL3 appear to support this hypothesis.

Immobilized Human at ANGPTL3 2 μg/mL (100 μL/well) can bind Monoclonal Anti-Human ANGPTL3 Antibody, the ED₅₀ of human ANGPTL3 protein is 2.741 ng/mL, corresponding to a specific activity is 3.6483×10^5 units/mg.

• 
  Immobilized Human at ANGPTL3 2 μg/mL (100 μL/well) can bind Monoclonal Anti-Human ANGPTL3 Antibody, the ED₅₀ of human ANGPTL3 protein is 2.741 ng/mL, corresponding to a specific activity is 3.6483×10⁵ units/mg.

Human

HEK293

C-6*His

Q9Y5C1 (S17-P220)

27329  [NCBI]

SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPHHHHHH

Approximately 30 kDa

• 
  Greater than 95 % as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Tarugi P, et al. Angiopoietin-like protein 3 (ANGPTL3) deficiency and familial combined hypolipidemia. J Biomed Res. 2019 Apr 22;33(2):73-81.  [Content Brief]

  [2]. Zeng L, et al. Identification of a novel human angiopoietin-like gene expressed mainly in heart. J Hum Genet. 2003;48(3):159-62.  [Content Brief]