Animal-Free BMP-9/GDF-2 Protein, Human (His)

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that selectively signals through AVRL1 in endothelial cells. Its signaling pathway requires the TGF-β coreceptor endoglin/ENG to effectively activate SMAD1. Animal-Free BMP-9/GDF-2 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-9/GDF-2 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free BMP-9/GDF-2 Protein, Human (His) is 110 a.a., with molecular weight of ~12.89 kDa.

BMP-9/GDF-2 Protein emerges as a potent circulating inhibitor of angiogenesis, specifically signaling through the type I activin receptor ACVRL1 while excluding other Alks. In endothelial cells, its signaling pathway involves the requirement for the TGF-beta coreceptor endoglin/ENG for efficient activation of SMAD1. Existing as a homodimer with disulfide-linked structures, BMP-9/GDF-2 is detected in extracellular fluid both as a mature homodimer and in complex with its propeptide. The protein establishes high-affinity interactions with ACVRL1, BMPR2, and ACVR2B, crucial for its signal transduction cascade. Furthermore, it forms complexes with ENG, either as a heterotetramer with a 2:2 stoichiometry or as a heteromeric complex with ENG and ACVRL1. Notably, it also interacts with the type I receptor ACVR1, contributing to the intricate regulatory network within the TGF-beta signaling pathway.

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is <0.4 ng/mL

Human

E. coli

N-His

Q9UK05 (S320-429R)

2658  [NCBI]

SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Approximately 12.89 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose.

<0.01 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.