1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TGF-beta Superfamily
  4. Bone Morphogenetic Proteins (BMPs) Growth Differentiation Factor
  5. BMP-9/GDF-2
  6. Animal-Free GDF-2/BMP-9 Protein, Human (His)

Animal-Free GDF-2/BMP-9 Protein, Human (His)

Cat. No.: HY-P700033AF
SDS COA Handling Instructions Technical Support

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that selectively signals through AVRL1 in endothelial cells. Its signaling pathway requires the TGF-β coreceptor endoglin/ENG to effectively activate SMAD1. Animal-Free GDF-2/BMP-9 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-9/GDF-2 protein, expressed by E. coli , with N-His labeled tag.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that selectively signals through AVRL1 in endothelial cells. Its signaling pathway requires the TGF-β coreceptor endoglin/ENG to effectively activate SMAD1. Animal-Free GDF-2/BMP-9 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-9/GDF-2 protein, expressed by E. coli , with N-His labeled tag.

Background

BMP-9/GDF-2 Protein emerges as a potent circulating inhibitor of angiogenesis, specifically signaling through the type I activin receptor ACVRL1 while excluding other Alks. In endothelial cells, its signaling pathway involves the requirement for the TGF-beta coreceptor endoglin/ENG for efficient activation of SMAD1. Existing as a homodimer with disulfide-linked structures, BMP-9/GDF-2 is detected in extracellular fluid both as a mature homodimer and in complex with its propeptide. The protein establishes high-affinity interactions with ACVRL1, BMPR2, and ACVR2B, crucial for its signal transduction cascade. Furthermore, it forms complexes with ENG, either as a heterotetramer with a 2:2 stoichiometry or as a heteromeric complex with ENG and ACVRL1. Notably, it also interacts with the type I receptor ACVR1, contributing to the intricate regulatory network within the TGF-beta signaling pathway.

Biological Activity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <0.4 ng/mL

Species

Human

Source

E. coli

Tag

N-His

Accession

Q9UK05 (S320-429R)

Gene ID
Molecular Construction
N-term
His
Animal-Free GDF-2/BMP-9 (S320-429R)
Accession # Q9UK05
C-term
Synonyms
GDF-2; BMP-9; GDF2; BMP9
AA Sequence

SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Molecular Weight

Approximately 12.89 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose or 20 mM sodium citrate, 0.2 M NaCl, pH 4.5.

Endotoxin Level

<0.01 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free GDF-2/BMP-9 Protein, Human (His)
Cat. No.:
HY-P700033AF
Quantity:
MCE Japan Authorized Agent: