Animal-Free CCL4 Protein, Mouse (His)

CCL4 protein, with inflammatory and chemokinetic properties, acts as a monokine and self-associates to form homodimers.Animal-Free CCL4 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCCL4 protein, expressed by E.coli , with N-His labeled tag.

CCL4 protein, characterized by its inflammatory and chemokinetic properties, functions as a monokine and forms homodimers.

Measureby its ability to chemoattract BaF3 cells transfected with human CCR5, The ED₅₀ for this effect is <4 ng/mL.

Mouse

E. coli

N-His

P14097 (A24-N92)

20303  [NCBI]

APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN

Approximately 8.64 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.