Animal-Free Galectin-10 Protein, Human (His)

Galectin-10 Protein, pivotal in immune regulation, recognizes cell-surface glycans, inducing anergy and suppressing CD25-positive regulatory T-cells (Treg). Interacting with CEL, it modulates immune responses, highlighting its significance in orchestrating immunoregulatory cellular processes. Animal-Free Galectin-10 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-10 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free Galectin-10 Protein, Human (His) is 141 a.a., with molecular weight of ~36.7 kDa.

The Galectin-10 protein plays a pivotal role in immune regulation by recognizing cell-surface glycans. It is indispensable for the induction of anergy and the suppressive function of CD25-positive regulatory T-cells (Treg). Through its interactions with CEL, Galectin-10 contributes to the modulation of immune responses, highlighting its significance in orchestrating cellular processes involved in immunoregulation.

Human

E. coli

N-His

Q05315 (S2-R142)

1178  [NCBI]

SLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR

Approximately 36.7 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.