1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-36
  5. IL-36β
  6. Animal-Free IL-36 beta/IL-1F8 Protein, Human (His)

Animal-Free IL-36 beta/IL-1F8 Protein, Human (His)

Cat. No.: HY-P74803AF
Data Sheet Handling Instructions Technical Support

IL-36 beta/IL-1F8 protein signals through IL-36R, activates NF-kappa-B and MAPK pathways, and induces pro-inflammatory responses.It is present in the epithelial barrier and shares the IL-1 system coreceptor IL1RAP.Animal-Free IL-36 beta/IL-1F8 Protein, Human (His) is the recombinant human-derived animal-FreeIL-36 beta/IL-1F8 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg USD 39 In-stock
10 μg USD 109 In-stock
50 μg USD 305 In-stock
100 μg   Get quote  

Get it by tomorrow June 3 for select sizes. Order within 3 hrs 14 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-36 beta/IL-1F8 protein signals through IL-36R, activates NF-kappa-B and MAPK pathways, and induces pro-inflammatory responses.It is present in the epithelial barrier and shares the IL-1 system coreceptor IL1RAP.Animal-Free IL-36 beta/IL-1F8 Protein, Human (His) is the recombinant human-derived animal-FreeIL-36 beta/IL-1F8 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Background

IL-36 beta/IL-1F8 protein is a cytokine that binds to and activates the IL1RL2/IL-36R receptor, leading to the activation of NF-kappa-B and MAPK signaling pathways in target cells, resulting in a pro-inflammatory response. It is part of the IL-36 signaling system, which is believed to be present in epithelial barriers and involved in local inflammatory responses, similar to the IL-1 system. IL-36 beta stimulates the production of interleukin-6 and interleukin-8 in various cell types, including synovial fibroblasts, articular chondrocytes, and mature adipocytes. It also induces the expression of antimicrobial peptides and matrix metalloproteases. In the skin, IL-36 beta acts on keratinocytes, dendritic cells, and indirectly on T-cells to promote tissue infiltration, cell maturation, and cell proliferation. In cultured keratinocytes, IL-36 beta induces the expression of chemokines and pro-inflammatory cytokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20, CXCL1, TNF-alpha, IL-8, and IL-6. It interacts with the cargo receptor TMED10, facilitating its translocation from the cytoplasm into the ERGIC and subsequent secretion.

Biological Activity

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is <0.2 ng/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

Q9NZH7-2 (R5-E157)

Gene ID
Molecular Construction
N-term
IL-36β (R5-E157)
Accession # Q9NZH7-2
His
C-term
Synonyms
Il36b; Fil1e; Il1f8; Interleukin-36 beta; Interleukin-1 family member 8; IL-1F8
AA Sequence

MREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE

Molecular Weight

Approximately 18.17 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Animal-Free IL-36 beta/IL-1F8 Protein, Human (His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-36 beta/IL-1F8 Protein, Human (His)
Cat. No.:
HY-P74803AF
Quantity:
MCE Japan Authorized Agent: