Animal-Free IL-36 beta/IL-1F8 Protein, Human (His)

IL-36 beta/IL-1F8 protein signals through IL-36R, activates NF-kappa-B and MAPK pathways, and induces pro-inflammatory responses.It is present in the epithelial barrier and shares the IL-1 system coreceptor IL1RAP.Animal-Free IL-36 beta/IL-1F8 Protein, Human (His) is the recombinant human-derived animal-FreeIL-36 beta/IL-1F8 protein, expressed by E.coli , with C-His labeled tag.

IL-36 beta/IL-1F8 protein is a cytokine that binds to and activates the IL1RL2/IL-36R receptor, leading to the activation of NF-kappa-B and MAPK signaling pathways in target cells, resulting in a pro-inflammatory response. It is part of the IL-36 signaling system, which is believed to be present in epithelial barriers and involved in local inflammatory responses, similar to the IL-1 system. IL-36 beta stimulates the production of interleukin-6 and interleukin-8 in various cell types, including synovial fibroblasts, articular chondrocytes, and mature adipocytes. It also induces the expression of antimicrobial peptides and matrix metalloproteases. In the skin, IL-36 beta acts on keratinocytes, dendritic cells, and indirectly on T-cells to promote tissue infiltration, cell maturation, and cell proliferation. In cultured keratinocytes, IL-36 beta induces the expression of chemokines and pro-inflammatory cytokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20, CXCL1, TNF-alpha, IL-8, and IL-6. It interacts with the cargo receptor TMED10, facilitating its translocation from the cytoplasm into the ERGIC and subsequent secretion.

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED₅₀ for this effect is <0.2 ng/mL.

Human

E. coli

C-His

Q9NZH7-2 (R5-E157)

27177  [NCBI]

MREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE

Approximately 18.17 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.