Animal-Free IL-36 gamma/IL-1F9 Protein, Mouse (His)

IL-36 gamma/IL-1F9 protein activates NF-κB through IL1RL2 and promotes local inflammatory responses in the epithelial barrier. It affects keratinocytes, dendritic cells and T cells, promoting tissue infiltration, cell maturation and proliferation. Animal-Free IL-36 gamma/IL-1F9 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36 gamma/IL-1F9 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-36 gamma/IL-1F9 Protein, Mouse (His) is 152 a.a., with molecular weight of ~18.27 kDa.

IL-36 gamma/IL-1F9 Protein acts as an agonist, activating NF-kappa B through the orphan IL-1-receptor-related protein 2/IL1RL2. As part of the IL-36 signaling system, it is believed to be present in epithelial barriers, contributing to local inflammatory responses, akin to the IL-1 system, sharing the coreceptor IL1RAP. This protein is implicated in skin inflammatory responses, influencing keratinocytes, dendritic cells, and, indirectly, T-cells to drive tissue infiltration, cell maturation, and proliferation. Additionally, it may play a role in pro-inflammatory responses during specific neutrophilic airway inflammations and contribute to the innate immune response against fungal pathogens. IL-36 gamma induces the production of various pro-inflammatory cytokines in bone marrow-derived dendritic cells (BMDCs) and enhances dendritic cell maturation by stimulating the surface expression of CD80, CD86, and MHC class II. Furthermore, it induces the production of IFN-gamma, IL-4, and IL-17 in cultured CD4(+) T-cells and splenocytes. The protein interacts with the cargo receptor TMED10, mediating translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and subsequent secretion.

Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED₅₀ for this effect is <15 ng/mL. The specific activity of recombinant mouse IL-36 gamma is >6 x10⁴ IU/mg

Mouse

E. coli

C-His

Q8R460 (G13-S164)

215257  [NCBI]

MGRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS

Approximately 18.27 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.