Animal-Free M-CSF Protein, Human (His)

The M-CSF protein regulates macrophage production, differentiation, and function. It exists as an active disulfide-linked homodimer outside of cells, generated through proteolytic cleavage. It may also play a role in placental development. Alternative splicing produces multiple transcript variants. M-CSF is widely expressed in tissues such as placenta, spleen, and 25 other tissues. Animal-Free M-CSF Protein, Human (His) is the recombinant human-derived animal-FreeM-CSF protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free M-CSF Protein, Human (His) is 232 a.a., with molecular weight of ~13.34 kDa.

The M-CSF protein is a cytokine that plays a key role in regulating the production, differentiation, and function of macrophages. It exists in an active form as a disulfide-linked homodimer, which is found outside of cells. This active form is believed to be generated through the proteolytic cleavage of membrane-bound precursors. Additionally, this protein may be involved in the development of the placenta. Alternative splicing gives rise to multiple transcript variants. The M-CSF protein exhibits widespread expression in various tissues, including the placenta (RPKM 19.9), spleen (RPKM 19.7), and 25 other tissues.

Measure by its ability to induce proliferation in NFS-60 cells. The ED₅₀ for this effect is <1 ng/mL. The specific activity of recombinant human M-CSF is approximately >2.5x10⁸ IU/mg.

Human

E. coli

C-His

NP_757350.2 (E33-S190)

1435  [NCBI]

MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

18.5 kDa under reducing (R) condition.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.