1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. CSF & Receptors
  4. M-CSF
  5. Animal-Free M-CSF Protein, Human (His)

The M-CSF protein regulates macrophage production, differentiation, and function. It exists as an active disulfide-linked homodimer outside of cells, generated through proteolytic cleavage. It may also play a role in placental development. Alternative splicing produces multiple transcript variants. M-CSF is widely expressed in tissues such as placenta, spleen, and 25 other tissues. Animal-Free M-CSF Protein, Human (His) is the recombinant human-derived animal-FreeM-CSF protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free M-CSF Protein, Human (His) is 232 a.a., with molecular weight of ~13.34 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Animal-Free M-CSF Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The M-CSF protein regulates macrophage production, differentiation, and function. It exists as an active disulfide-linked homodimer outside of cells, generated through proteolytic cleavage. It may also play a role in placental development. Alternative splicing produces multiple transcript variants. M-CSF is widely expressed in tissues such as placenta, spleen, and 25 other tissues. Animal-Free M-CSF Protein, Human (His) is the recombinant human-derived animal-FreeM-CSF protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free M-CSF Protein, Human (His) is 232 a.a., with molecular weight of ~13.34 kDa.

Background

The M-CSF protein is a cytokine that plays a key role in regulating the production, differentiation, and function of macrophages. It exists in an active form as a disulfide-linked homodimer, which is found outside of cells. This active form is believed to be generated through the proteolytic cleavage of membrane-bound precursors. Additionally, this protein may be involved in the development of the placenta. Alternative splicing gives rise to multiple transcript variants. The M-CSF protein exhibits widespread expression in various tissues, including the placenta (RPKM 19.9), spleen (RPKM 19.7), and 25 other tissues.

Biological Activity

Measure by its ability to induce proliferation in NFS-60 cells. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant human M-CSF is approximately >2.5x108 IU/mg.

Species

Human

Source

E. coli

Tag

C-His

Accession

NP_757350.2 (E33-S190)

Gene ID
Molecular Construction
N-term
M-CSF (E33-S190)
Accession # NP_757350.2
His
C-term
Synonyms
Macrophage Colony-Stimulating Factor 1; CSF-1; M-CSF; MCSF; Lanimostim; CSF1
AA Sequence

MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

Molecular Weight

18.5 kDa under reducing (R) condition.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free M-CSF Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free M-CSF Protein, Human (His)
Cat. No.:
HY-P700137AF
Quantity:
MCE Japan Authorized Agent: