1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. CSF & Receptors
  4. M-CSF
  5. Animal-Free M-CSF Protein, Mouse (His)

The M-CSF protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a key role in innate immunity and inflammatory processes. Animal-Free M-CSF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeM-CSF protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free M-CSF Protein, Mouse (His) is 155 a.a., with molecular weight of ~19.02 kDa.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The M-CSF protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a key role in innate immunity and inflammatory processes. Animal-Free M-CSF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeM-CSF protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free M-CSF Protein, Mouse (His) is 155 a.a., with molecular weight of ~19.02 kDa.This product is for cell culture use only.

Background

M-CSF Protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a pivotal role in innate immunity and inflammatory processes. Additionally, M-CSF assumes a crucial role in the regulation of osteoclast proliferation and differentiation, influencing bone resorption, and contributing to normal bone development. Beyond its skeletal impact, M-CSF is indispensable for normal male and female fertility. The cytokine also facilitates the reorganization of the actin cytoskeleton, regulates the formation of membrane ruffles, cell adhesion, and cell migration. It further plays a role in lipoprotein clearance. M-CSF exists in multiple forms, including a homodimer with two identical 150-200 kDa proteoglycan subunits, a heterodimer with a 150-200 kDa proteoglycan subunit and a truncated 43 kDa subunit, and a homodimer with two identical 43 kDa subunits. The protein's diverse functions are mediated through its interaction with the receptor CSF1R.

Biological Activity

Measure by its ability to induce proliferation in NFS-60 cells. The ED50 for this effect is <2 ng/mL. The specific activity of recombinant mouse M-CSF is approximately >5 x 105 IU/mg.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

P07141 (K33-P187)

Gene ID
Molecular Construction
N-term
M-CSF (K33-P187)
Accession # P07141
His
C-term
Synonyms
rMuM-CSF; CSF-1; MGI-IM
AA Sequence

MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP

Molecular Weight

Approximately 19.02 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free M-CSF Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free M-CSF Protein, Mouse (His)
Cat. No.:
HY-P700222AF
Quantity:
MCE Japan Authorized Agent: