APE Protein, Human

APE Protein, Human is an approximately 40.0 kDa protein expressed by E. coli expression system. Human APE plays an important role in BER by acting downstream of DNA glycosylases^[1].

Human APE is a 36-kDa multifunctional protein that performs essential functions in DNA repair, transcription, RNA biogenesis, and cell proliferation. Additionally, DNA substrate specificity of APE1 is modulated by concentrations of divalent cations, pH, and ionic strength in an apparently allosteric manner^[1].

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

Tag Free

P27695 (P2-L318)

328  [NCBI]

PKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL

Approximately 40.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filter solution of 10 mM HEPES, 100 mM KCl, 50% Glycerol, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Olga A Kladova, et al. The role of the N-terminal domain of human apurinic/apyrimidinic endonuclease 1, APE1, in DNA glycosylase stimulation.DNA Repair (Amst). 2018 Apr;64:10-25  [Content Brief]