IL-4 Protein, Mouse

IL-4 Protein is a pleiotropic cytokine secreted by immune cells such as Th2. IL-4 Protein is involved in various processes, including humoral immunity, Th cell differentiation, allergic reactions, and inflammatory responses. IL-4 Protein plays a key role in immune responses and inflammatory reactions. IL-4 Protein, Mouse is a recombinant IL-4 protein expressed by E. coli without a tag^[1][2][3].

IL-4 is a core cytokine of the Th2-type immune response. As a pleiotropic cytokine, IL-4 is secreted by various cells such as Th2 cells, NKT cells, and mast cells. By binding to type I and type II receptors, IL-4 activates signaling pathways including JAK-STAT6, playing a central role in Th2 cell differentiation, B-cell immunoglobulin class switching (such as the production of IgE and IgG1), and M2 macrophage polarization. Aberrant expression of IL-4 is closely associated with allergic diseases like asthma and atopic dermatitis, as well as immune responses to parasitic infections^[1][2][3].

IL-4 Protein (Mouse; 0-10 ng/mL; 0-10 days) can prolong the survival time of mouse peritoneal exudate macrophages (PEM) in vitro. When used in combination with M-CSF (HY-P7050), it promotes cell proliferation, while when used in combination with GM-CSF (HY-P7361), it inhibits cell proliferation^[4].
IL-4 Protein (Mouse; 0-50 ng/mL; 48-120 h) can induce the proliferation of lymph node cells in BALB/c mice and induce Th2 differentiation and IL-4 production in CD4⁺ T cells of BALB/c mice^[5].

IL-4 protein (Mouse; 0.5-5 μg/kg; subcutaneous injection; 30 days) can improve psoriatic-like phenotypes, reduce inflammatory cell infiltration, decrease the expression of adhesion molecules, and exhibit activities in improving angiogenesis and inflammation in K14-VEGF transgenic mice^[6].

1. Measured in a cell proliferation assay using M-NFS-60 mouse lymphoblast cells. The ED₅₀ for this effect is ≤10 pg/mL.
2. Measured in a cell proliferation assay using HT-2 cells. The ED₅₀ for this effect is ≤1.437 ng/mL, corresponding to a specific activity is ≥6.96×10⁵ units/mg.

• 
  Measured in a cell proliferation assay using HT-2 cells. The ED₅₀ for this effect is 1.437 ng/mL, corresponding to a specific activity is 6.96×10⁵ units/mg.

Mouse

E. coli

Tag Free

P07750 (H23-S140)

16189  [NCBI]

HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Approximately 12-15 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 300 mM NaCl, 5% Trehalose, pH 6.5 or PBS, pH 7.4, 5% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. I-Cheng Ho,et al. Regulation of IL-4 Expression in Immunity and Diseases. Adv Exp Med Biol. 2016;941:31-77.  [Content Brief]

  [2]. Keegan AD, et al. Recent advances in understanding the role of IL-4 signaling. Fac Rev. 2021 Sep 7;10:71.  [Content Brief]

  [3]. Choi P, et al. IL-4: role in disease and regulation of production. Clin Exp Immunol. 1998 Sep;113(3):317-9.  [Content Brief]

  [4]. Chen BD, et al. Murine recombinant IL-4 is a bifunctional regulator of macrophage growth induced by colony-stimulating factors. J Immunol. 1992 Feb 1;148(3):753-9.  [Content Brief]

  [5]. Myburgh E, et al. Murine IL-4 is able to signal via chimeric human IL-4Ralpha/mouse gamma-chain receptor. Mol Immunol. 2008 Mar;45(5):1327-36.  [Content Brief]

  [6]. Ren X,et al. Recombinant murine interleukin 4 protein therapy for psoriasis in a transgenic VEGF mouse model. Dermatology. 2009;219(3):232-8.  [Content Brief]