IL-4 Protein, Mouse

IL-4 Protein, Mouse is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression.

IL-4 is a T cell-derived growth factor for B cells. In addition to T cells, IL-4 is produced by innate lymphocytes, such as NTK cells, and myeloid cells, such as basophils and mast cells. It is a signature cytokine of type 2 immune response but also has a nonimmune function. Its expression is tightly regulated at several levels, including signaling pathways, transcription factors, epigenetic modifications, microRNA, and long noncoding RNA. Produced by mast cells, T cells and bone marrow stromal cells, IL-4 regulates the differentiation of naive CD4⁺ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergy^[1].

1. Measured in a cell proliferation assay using M-NFS-60 mouse lymphoblast cells. The ED₅₀ for this effect is ≤10 pg/mL.
2. Measured in a cell proliferation assay using HT-2 cells. The ED₅₀ for this effect is ≤1.437 ng/mL, corresponding to a specific activity is ≥6.96×10⁵ units/mg.

• 
  Measured in a cell proliferation assay using HT-2 cells. The ED₅₀ for this effect is 1.437 ng/mL, corresponding to a specific activity is 6.96×10⁵ units/mg.

Mouse

E. coli

Tag Free

P07750 (H23-S140)

16189  [NCBI]

HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Approximately 12-15 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 300 mM NaCl, 5% Trehalose, pH 6.5 or PBS, pH 7.4, 5% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. I-Cheng Ho,et al. Regulation of IL-4 Expression in Immunity and Diseases. Adv Exp Med Biol. 2016;941:31-77.  [Content Brief]