ASGR2/ASGPR2 Protein, Mouse (His-SUMO)

ASGR2/ASGPR2 proteins are critical in cellular processes, mediating the endocytosis of desialylated plasma glycoproteins. It recognizes terminal galactose and N-acetylgalactosamine, promotes ligand internalization, and forms complexes that are transported to sorting organelles. ASGR2/ASGPR2 Protein, Mouse (His-SUMO) is the recombinant mouse-derived ASGR2/ASGPR2 protein, expressed by E. coli , with N-10*His, N-SUMO labeled tag. The total length of ASGR2/ASGPR2 Protein, Mouse (His-SUMO) is 222 a.a., with molecular weight of ~45.9 kDa.

ASGR2/ASGPR2 Protein plays a crucial role in cellular processes by mediating the endocytosis of plasma glycoproteins from which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. Recognizing terminal galactose and N-acetylgalactosamine units, the receptor facilitates the internalization of ligands, forming a complex that is subsequently transported to a sorting organelle. Within this organelle, the receptor and ligand dissociate, and the receptor is then recycled back to the cell membrane surface. ASGR2/ASGPR2's engagement in these dynamic processes highlights its significance in the cellular handling of glycoproteins and contributes to the regulation of cellular homeostasis. The protein also interacts with LASS2, further expanding its molecular associations and potential implications in cellular signaling or coordination.

Mouse

E. coli

N-10*His;N-SUMO

P24721 (Q80-H301)

11890  [NCBI]

QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH

Approximately 45.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.