PGCP Protein, Mouse (HEK293, His)

PGCP is a carboxypeptidase with a potentially critical role in the hydrolysis of circulating peptides. It catalyzes the cleavage of terminally unsubstituted dipeptides, releasing amino acids. PGCP Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGCP protein, expressed by HEK293 , with C-6*His labeled tag. The total length of PGCP Protein, Mouse (HEK293, His) is 452 a.a., with molecular weight of ~60.0 kDa.

PGCP (peptidoglycan recognition protein 2) is a carboxypeptidase with a potential key role in the hydrolysis of circulating peptides. This enzyme catalyzes the hydrolysis of dipeptides with unsubstituted terminals, breaking them down into individual amino acids. There is a suggestion that PGCP may participate in the liberation of thyroxine hormone from its thyroglobulin precursor, indicating a potential involvement in thyroid hormone regulation. Structurally, PGCP exists as a homodimer, with the monomeric form being inactive while the homodimer configuration exhibits enzymatic activity. This dimeric structure suggests a regulatory mechanism for the activation of PGCP, emphasizing its significance in the processing and metabolism of circulating peptides.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Mouse

HEK293

C-6*His

Q9WVJ3 (K19-S470)

54381  [NCBI]

KAVFKNGVSQRTFREIKEEIANYEDVAKAIINLAVYGKYQNRSYERLGLLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLENVHLEQVRIPHWERGEESAVMLEPRIHKMAILGLGSSIGTPPGGITAEVLVVASFDELQRRASEARGKIIVYNQPYTGYEKTVQYRVQGAVEAAKVGAVASLIQSVASFSIYSPHTGIQKYQDGVPKIPTACITVEDAEMMSRMASRGNKIVIHLEMGAKTYPDTDSFNTVAEITGSMYPEEVVLVSGHLDSWDVGQGALDDGGGAFISWEALSLVKDLGLRPKRTLRLVLWTAEEQGGIGASQYYELHKANISKYSLVMEADSGTFLPTGLQFTGSDKARAIMKEVMNLLQPLNVTKVFSNGEGTDINFWIQAGVPGASLRDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVAYVVADMDEMLPRS

Approximately 56 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.