PGCP Protein, Mouse (HEK293, His)

PGCP is a carboxypeptidase with a potentially critical role in the hydrolysis of circulating peptides. It catalyzes the cleavage of terminally unsubstituted dipeptides, releasing amino acids. PGCP Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGCP protein, expressed by HEK293 , with C-6*His labeled tag. The total length of PGCP Protein, Mouse (HEK293, His) is 452 a.a., with molecular weight of ~60.0 kDa.

PGCP (peptidoglycan recognition protein 2) is a carboxypeptidase with a potential key role in the hydrolysis of circulating peptides. This enzyme catalyzes the hydrolysis of dipeptides with unsubstituted terminals, breaking them down into individual amino acids. There is a suggestion that PGCP may participate in the liberation of thyroxine hormone from its thyroglobulin precursor, indicating a potential involvement in thyroid hormone regulation. Structurally, PGCP exists as a homodimer, with the monomeric form being inactive while the homodimer configuration exhibits enzymatic activity. This dimeric structure suggests a regulatory mechanism for the activation of PGCP, emphasizing its significance in the processing and metabolism of circulating peptides.

Mouse

HEK293

C-6*His

Q9WVJ3 (K19-S470)

54381  [NCBI]

KAVFKNGVSQRTFREIKEEIANYEDVAKAIINLAVYGKYQNRSYERLGLLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLENVHLEQVRIPHWERGEESAVMLEPRIHKMAILGLGSSIGTPPGGITAEVLVVASFDELQRRASEARGKIIVYNQPYTGYEKTVQYRVQGAVEAAKVGAVASLIQSVASFSIYSPHTGIQKYQDGVPKIPTACITVEDAEMMSRMASRGNKIVIHLEMGAKTYPDTDSFNTVAEITGSMYPEEVVLVSGHLDSWDVGQGALDDGGGAFISWEALSLVKDLGLRPKRTLRLVLWTAEEQGGIGASQYYELHKANISKYSLVMEADSGTFLPTGLQFTGSDKARAIMKEVMNLLQPLNVTKVFSNGEGTDINFWIQAGVPGASLRDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVAYVVADMDEMLPRS

Approximately 60.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.