Biotinidase/BTD Protein, Human (HEK293, His)

Biotinidase is our subject of interest, playing a key role in the catalytic release of biotin from biocytin, a by-product formed during biotin-dependent carboxylase degradation. This enzymatic process is essential to recycle biotin, an important cofactor, and ensure its participation in various carboxylation reactions. Biotinidase/BTD Protein, Human (HEK293, His) is the recombinant human-derived Biotinidase/BTD protein, expressed by HEK293 , with C-10*His labeled tag. The total length of Biotinidase/BTD Protein, Human (HEK293, His) is 502 a.a., with molecular weight of 75-90 kDa.

Biotinidase, encoded by the BTD gene, is an enzyme that plays a crucial role in catalyzing the release of biotin from biocytin, which is the product of the degradation of biotin-dependent carboxylases. This enzymatic activity is essential for recycling biotin, a water-soluble B-vitamin, from biocytin, allowing it to be utilized again by biotin-dependent carboxylases in various metabolic pathways. Biotinidase deficiency, a rare genetic disorder, can lead to the impaired recycling of biotin, resulting in a range of neurological and cutaneous symptoms. The catalytic function of biotinidase underscores its significance in maintaining biotin homeostasis and ensuring the continuous availability of biotin for various biochemical processes in the cell.

Measured by its ability to hydrolyze the substrate biotin 4-Nitrophenyl ester (BNP). The specific activity is 99.92 pmoL/min/μg, as measured under the described conditions.

Human

HEK293

C-10*His

P43251 (A42-D543)

686  [NCBI]

AHTGEESVADHHEAEYYVAAVYEHPSILSLNPLALISRQEALELMNQNLDIYEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSNGLCCYLLYERPTLSKELYALGVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSYIFPLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLYERD

75-90 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.