Carbonic Anhydrase 11 Protein, Human (HEK293, His)

Carbonic Anhydrase 11 Protein, Human (HEK293, His) is an approximately 38.0 kDa carbonic anhydrase 11 protein with a His-flag. Carbonic anhydrases (CAs) are found in many organisms, in which they contribute to several important biological processes^[1].

Carbonic Anhydrase 11 belongs to the carbonic anhydrase (CA) family and may be involved in cell proliferation and cellular transformation. CAs are zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide and thus participate in a variety of biological and physical processes^[1].
Carbonic Anhydrase 11 are found in many organisms, in which they contribute to several important biological processes. Positive signals for CARP XI can be observed in the cerebellum, cerebrum, liver, stomach, small intestine, colon, kidney, and testis^[2].

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-6*His

O75493 (V64-R328)

770  [NCBI]

HIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGVPHGRHHHHHH

Approximately 38.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filter solution of 20 mM PB,150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. J A Loncaster, et al. Carbonic anhydrase (CA IX) expression, a potential new intrinsic marker of hypoxia: correlations with tumor oxygen measurements and prognosis in locally advanced carcinoma of the cervix. Cancer Res. 2001 Sep 1;61(17):6394-9.  [Content Brief]

  [2]. K Taniuchi, et al. Developmental expression of carbonic anhydrase-related proteins VIII, X, and XI in the human brain. Neuroscience. 2002;112(1):93-9.  [Content Brief]