Carboxypeptidase B2/CPB2 Protein, Mouse (HEK293, His)

Carboxypeptidase B2/CPB2 protein cleaves C-terminal arginine or lysine residues from active peptides, regulating their activities. It also down-regulates fibrinolysis by removing C-terminal lysine residues from degraded fibrin. CPB2 contributes to peptide signaling and fibrinolysis regulation. Carboxypeptidase B2/CPB2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Carboxypeptidase B2/CPB2 protein, expressed by HEK293 , with C-His labeled tag.

Carboxypeptidase B2/CPB2 protein functions by cleaving C-terminal arginine or lysine residues from biologically active peptides, such as kinins or anaphylatoxins, in the circulation, thereby regulating their activities. It also plays a role in down-regulating fibrinolysis by removing C-terminal lysine residues from partially degraded fibrin, which has been acted upon by plasmin. This protein thus contributes to the fine-tuning of peptide signaling and the regulation of fibrinolysis processes.

Specific activity is determined by a kinetic assay using Hippuryl-L-Arginine as substrate. One unit equals one micromole of Hippuryl-L-Arginine hyrolyzed per minute. Specific activity is reported in Units per milligram. The specific activity is 3.27 U/mg.

Mouse

HEK293

C-10*His

Q9JHH6 (F22-T422)

56373  [NCBI]

FQSGQVLSALPRTSRQVQLLQNLTTTYEVVLWQPVTAEFIEKKKEVHFFVNASDVDSVKAHLNVSRIPFNVLMNNVEDLIEQQTFNDTVSPRASASYYEQYHSLNEIYSWIEVITEQHPDMLQKIYIGSSFEKYPLYVLKVSGKEQRIKNAIWIDCGIHAREWISPAFCLWFIGYVTQFHGKENLYTRLLRHVDFYIMPVMNVDGYDYTWKKNRMWRKNRSAHKNNRCVGTDLNRNFASKHWCEKGASSSSCSETYCGLYPESEPEVKAVADFLRRNIDHIKAYISMHSYSQQILFPYSYNRSKSKDHEELSLVASEAVRAIESINKNTRYTHGSGSESLYLAPGGSDDWIYDLGIKYSFTIELRDTGRYGFLLPERYIKPTCAEALAAISKIVWHVIRNT

Approximately 52-75 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.