1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Cardiotrophin-1
  5. Cardiotrophin-1/CTF1 Protein, Human (HEK293, Fc)

Cardiotrophin-1/CTF1 Protein, Human (HEK293, Fc)

Cat. No.: HY-P72871
Data Sheet SDS COA Handling Instructions Technical Support

Cardiotrophin-1/CTF1 protein induces cardiac myocyte hypertrophy in vitro by binding to and activating the ILST/gp130 receptor, highlighting its regulatory role in heart muscle cell enlargement. This engagement orchestrates signaling events that contribute to the hypertrophic response, providing insight into the mechanisms of cardiac hypertrophy and implicating Cardiotrophin-1 in heart muscle growth. Cardiotrophin-1/CTF1 Protein, Human (HEK293, Fc) is the recombinant human-derived Cardiotrophin-1/CTF1 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of Cardiotrophin-1/CTF1 Protein, Human (HEK293, Fc) is 200 a.a., with molecular weight of 54 & 37 kDa, respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cardiotrophin-1/CTF1 protein induces cardiac myocyte hypertrophy in vitro by binding to and activating the ILST/gp130 receptor, highlighting its regulatory role in heart muscle cell enlargement. This engagement orchestrates signaling events that contribute to the hypertrophic response, providing insight into the mechanisms of cardiac hypertrophy and implicating Cardiotrophin-1 in heart muscle growth. Cardiotrophin-1/CTF1 Protein, Human (HEK293, Fc) is the recombinant human-derived Cardiotrophin-1/CTF1 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of Cardiotrophin-1/CTF1 Protein, Human (HEK293, Fc) is 200 a.a., with molecular weight of 54 & 37 kDa, respectively.

Background

Cardiotrophin-1/CTF1 protein serves as a potent inducer of cardiac myocyte hypertrophy in vitro, underscoring its regulatory role in the enlargement of heart muscle cells. This effect is mediated through its binding to and activation of the ILST/gp130 receptor, indicating a specific molecular pathway through which Cardiotrophin-1 exerts its influence. By engaging with the ILST/gp130 receptor, Cardiotrophin-1 orchestrates signaling events that contribute to the hypertrophic response in cardiac myocytes. This molecular insight into the interaction between Cardiotrophin-1 and its receptor provides a foundational understanding of the mechanisms underlying cardiac hypertrophy and implicates this protein in the modulation of heart muscle growth.

Biological Activity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells and the ED50 is typically 0.015-0.06 μg/mL.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

Q16619 (S2-A201)

Gene ID
Molecular Construction
N-term
hFc
CTF1 (S2-A201)
Accession # Q16619
C-term
Synonyms
Cardiotrophin-1; CT-1; CTF1
AA Sequence

SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA

Molecular Weight

54&37 kDa

Purity

Greater than 80% as determined by reducing SDS-PAGE

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Cardiotrophin-1/CTF1 Protein, Human (HEK293, Fc) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cardiotrophin-1/CTF1 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P72871
Quantity:
MCE Japan Authorized Agent: