Cardiotrophin-1/CTF1 Protein, Human (HEK293, Fc)

Cardiotrophin-1/CTF1 protein induces cardiac myocyte hypertrophy in vitro by binding to and activating the ILST/gp130 receptor, highlighting its regulatory role in heart muscle cell enlargement. This engagement orchestrates signaling events that contribute to the hypertrophic response, providing insight into the mechanisms of cardiac hypertrophy and implicating Cardiotrophin-1 in heart muscle growth. Cardiotrophin-1/CTF1 Protein, Human (HEK293, Fc) is the recombinant human-derived Cardiotrophin-1/CTF1 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of Cardiotrophin-1/CTF1 Protein, Human (HEK293, Fc) is 200 a.a., with molecular weight of 54 & 37 kDa, respectively.

Cardiotrophin-1/CTF1 protein serves as a potent inducer of cardiac myocyte hypertrophy in vitro, underscoring its regulatory role in the enlargement of heart muscle cells. This effect is mediated through its binding to and activation of the ILST/gp130 receptor, indicating a specific molecular pathway through which Cardiotrophin-1 exerts its influence. By engaging with the ILST/gp130 receptor, Cardiotrophin-1 orchestrates signaling events that contribute to the hypertrophic response in cardiac myocytes. This molecular insight into the interaction between Cardiotrophin-1 and its receptor provides a foundational understanding of the mechanisms underlying cardiac hypertrophy and implicates this protein in the modulation of heart muscle growth.

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells and the ED₅₀ is typically 0.015-0.06 μg/mL.

Human

HEK293

N-hFc

Q16619 (S2-A201)

1489  [NCBI]

SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA

54&37 kDa

Greater than 80% as determined by reducing SDS-PAGE

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.