CD200 Protein, Human (HEK293, Fc)

CD200 Protein stimulates T-cell proliferation and regulates myeloid cell activity in tissues. It interacts with CD200R1 through their Ig-like domains, indicating its role in immune response modulation and maintaining cellular homeostasis. CD200 Protein, Human (HEK293, Fc) is the recombinant human-derived CD200 protein, expressed by HEK293 , with C-hFc labeled tag.

CD200 Protein acts as a potent costimulator for T-cell proliferation and is implicated in regulating myeloid cell activity across various tissues. Its functional interplay with CD200R1 is facilitated through the interaction of their N-terminal Ig-like domains, suggesting a pivotal role in modulating immune responses and maintaining homeostasis within diverse cellular environments.

Human

HEK293

C-hFc

P41217-1 (Q31-G232)

4345  [NCBI]

QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG

65-90 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.