CD200R1 Protein, Cynomolgus (HEK293, His)

CD200R1 Protein is an Ig superfamily transmembrane glycoprotein expressed on the surface of myeloid cells. CD200R1 Protein can also be induced in certain T-cell subsets. CD200R1 signaling inhibits the expression of proinflammatory molecules^[1]. CD200R1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD200R1 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD200R1 Protein, Cynomolgus (HEK293, His) is 221 a.a., with molecular weight of 43-75 KDa.

CD200R1 is an Ig superfamily transmembrane glycoprotein expressed on the surface of myeloid cells; it can also be induced in certain T-cell subsets. CD200R1 interacts with CD200, which is also an Ig superfamily transmembrane glycoprotein, to down regulate myeloid cell functions. CD200 is expressed on the surface of a variety of cells including neurons, epithelial cells, endothelial cells, fibroblasts, lymphoid cells, and astrocytes. The regulation of CD200R1 signaling can occur by posttranslational modification-namely, phosphorylation of tyrosines in the CD200R1 cytoplasmic tail-or by the inducible expression or downregulation of either CD200R1 or CD200. The CD200:CD200R1 inhibitory signaling pathway has been implicated in playing a prominent role in limiting inflammation in a wide range of inflammatory diseases. CD200R1 signaling inhibits the expression of proinflammatory molecules including tumor necrosis factor, interferons, and inducible nitric oxide synthase in response to selected stimuli^[1].

1.Immobilized Cynomolgus CD200R at 2 μg/mL (100 μL/well) can bind Rhesus macaque CD200. The ED₅₀ for this effect is 9.602 ng/mL.
2.Immobilized Cynomolgus CD200R at 0.5 μg/mL (100 μL/well) can bind Rhesus macaque CD200. The ED₅₀ for this effect is ≤24 ng/mL.

• 
  Immobilized Cynomolgus CD200R at 2 μg/mL (100 μL/well) can bind Rhesus macaque CD200. The ED₅₀ for this effect is 9.602 ng/mL.

Cynomolgus

HEK293

C-His

XP_005548207.1 (S47-L267)

102139962  [NCBI]

SNSLCMDEKQITQNHSKVLAEVNISWPVQMARNAVLCCPPIEFRNLIVITWEIILRGQPSCTKTYRKDTNETKETNCTDERITWVSTPDQNSDLQIHPVAITHDGYYRCIMATPDGNFHRGYHLQVLVTPEVTLFESRNRTAVCKAVAGKPAAQISWIPAGDCAPTEQEYWGNGTVTVKSTCHWEGHNVSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKL

Approximately 43-75 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.