1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens Biotinylated Proteins
  3. Inhibitory Checkpoint Molecules Stem Cell CD Proteins Platelet CD Proteins Erythrocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. Integrin Associated Protein/CD47
  5. CD47 Protein, Human (Biotinylated, HEK293, His-Avi)

CD47 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78095
SDS COA Handling Instructions

CD47 is an adhesion protein that regulates integrin signaling through G protein activation and serves as a receptor for thrombospondin THBS1, affecting signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, self-renewal and Immunomodulatory. It regulates pulmonary endothelin EDN1 signaling, acts as a pressor in blood pressure regulation, and is critical for memory formation. CD47 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD47 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of CD47 Protein, Human (Biotinylated, HEK293, His-Avi) is 121 a.a., with molecular weight of 45-55 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg $255 In-stock
50 μg $561 In-stock
100 μg $945 Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD47 is an adhesion protein that regulates integrin signaling through G protein activation and serves as a receptor for thrombospondin THBS1, affecting signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, self-renewal and Immunomodulatory. It regulates pulmonary endothelin EDN1 signaling, acts as a pressor in blood pressure regulation, and is critical for memory formation. CD47 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD47 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of CD47 Protein, Human (Biotinylated, HEK293, His-Avi) is 121 a.a., with molecular weight of 45-55 kDa.

Background

CD47, an adhesive protein, facilitates cell-to-cell interactions and serves as a receptor for thrombospondin THBS1, modulating integrin signaling through the activation of heterotrimeric G proteins. Involved in diverse cellular processes, CD47 contributes to signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cellular self-renewal, and immunoregulation. Notably, it plays a role in modulating pulmonary endothelin EDN1 signaling and functions as a pressor agent in the regulation of blood pressure in response to THBS1. CD47 is crucial for memory formation and synaptic plasticity in the hippocampus, acting as a receptor for SIRPA and SIRPG, which impacts dendritic cell maturation, cytokine production, cell-cell adhesion, and T-cell activation. Furthermore, CD47 positively modulates FAS-dependent apoptosis in T-cells and suppresses angiogenesis, contributing to metabolic dysregulation during aging. In response to THBS1, CD47 negatively modulates wound healing, inhibits stem cell self-renewal, and may play a role in membrane transport and/or integrin-dependent signal transduction. As a monomer, CD47 interacts with THBS1, SIRPA, FAS/CD95, SIRPG, UBQLN1, UBQLN2, and potentially fibrinogen, highlighting its intricate involvement in cellular and molecular pathways.

Biological Activity

Immobilized Human SIRP alpha, hFc Tag at 1 μg/ml (100 μl/Well) on the plate. Dose response curve for Biotinylated Human CD47, His Tag with the EC50 of 0.48-0.83 μg/ml determined by ELISA.

Species

Human

Source

HEK293

Tag

C-Avi;C-His

Accession

Q08722-1 (Q19-P139)

Gene ID

961  [NCBI]

Molecular Construction
N-term
CD47 (Q19-P139)
Accession # Q08722-1
His-Avi
C-term
Synonyms
CD47 glycoprotein; CD47 molecule; CD47; IAP; OA3; MER6
AA Sequence

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Weight

45-55 kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD47 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78095
Quantity:
MCE Japan Authorized Agent: