CD47 Protein, Human (Biotinylated, HEK293, His-Avi)

CD47 is an adhesion protein that regulates integrin signaling through G protein activation and serves as a receptor for thrombospondin THBS1, affecting signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, self-renewal and Immunomodulatory. It regulates pulmonary endothelin EDN1 signaling, acts as a pressor in blood pressure regulation, and is critical for memory formation. CD47 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD47 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of CD47 Protein, Human (Biotinylated, HEK293, His-Avi) is 121 a.a., with molecular weight of 45-55 kDa.

CD47, an adhesive protein, facilitates cell-to-cell interactions and serves as a receptor for thrombospondin THBS1, modulating integrin signaling through the activation of heterotrimeric G proteins. Involved in diverse cellular processes, CD47 contributes to signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cellular self-renewal, and immunoregulation. Notably, it plays a role in modulating pulmonary endothelin EDN1 signaling and functions as a pressor agent in the regulation of blood pressure in response to THBS1. CD47 is crucial for memory formation and synaptic plasticity in the hippocampus, acting as a receptor for SIRPA and SIRPG, which impacts dendritic cell maturation, cytokine production, cell-cell adhesion, and T-cell activation. Furthermore, CD47 positively modulates FAS-dependent apoptosis in T-cells and suppresses angiogenesis, contributing to metabolic dysregulation during aging. In response to THBS1, CD47 negatively modulates wound healing, inhibits stem cell self-renewal, and may play a role in membrane transport and/or integrin-dependent signal transduction. As a monomer, CD47 interacts with THBS1, SIRPA, FAS/CD95, SIRPG, UBQLN1, UBQLN2, and potentially fibrinogen, highlighting its intricate involvement in cellular and molecular pathways.

Immobilized Human SIRP alpha, hFc Tag at 1 μg/ml (100 μl/Well) on the plate. Dose response curve for Biotinylated Human CD47, His Tag with the EC₅₀ of 0.48-0.83 μg/ml determined by ELISA.

Human

HEK293

C-Avi;C-His

Q08722-1 (Q19-P139)

961  [NCBI]

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

45-55 kDa

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.