1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Endothelial cell CD Proteins Pattern Recognition Receptors
  4. DC-SIGN1/CD209 DC-SIGN1/CD209 C-type Lectin Receptors
  5. DC-SIGN/CD209 Protein, Rhesus Macaque (HEK293, His)

DC-SIGN/CD209 Protein, Rhesus Macaque (HEK293, His)

Cat. No.: HY-P74205
SDS COA Handling Instructions Technical Support

DC-SIGN/CD209 Protein, is a C-type lectin receptor present on the surface of both macrophages and dendritic cells (DCs), serves as a pivotal pathogen-recognition receptor, playing a crucial role in initiating the primary immune response. It mediates endocytosis and subsequent degradation of pathogens within lysosomal compartments. On DCs, it acts as a high-affinity receptor for ICAM2 and ICAM3, binding to mannose-like carbohydrates. DC-SIGN/CD209 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived DC-SIGN/CD209 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DC-SIGN/CD209 Protein, is a C-type lectin receptor present on the surface of both macrophages and dendritic cells (DCs), serves as a pivotal pathogen-recognition receptor, playing a crucial role in initiating the primary immune response. It mediates endocytosis and subsequent degradation of pathogens within lysosomal compartments. On DCs, it acts as a high-affinity receptor for ICAM2 and ICAM3, binding to mannose-like carbohydrates. DC-SIGN/CD209 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived DC-SIGN/CD209 protein, expressed by HEK293 , with N-His labeled tag.

Background

DC-SIGN/CD209 protein, is a C-type lectin receptor present on the surface of both macrophages and dendritic cells (DCs), serves as a pivotal pathogen-recognition receptor, playing a crucial role in initiating the primary immune response. This receptor is implicated in the endocytosis of pathogens, leading to their subsequent degradation within lysosomal compartments. Following this process, DC-SIGN returns to the cell membrane surface, presenting pathogen-derived antigens to resting T-cells through MHC class II proteins, thereby triggering the adaptive immune response. On DCs, it acts as a high-affinity receptor for ICAM2 and ICAM3, binding to mannose-like carbohydrates. Notably, DC-SIGN may function as a DC rolling receptor, facilitating the transendothelial migration of DC precursors from the bloodstream to tissues by interacting with endothelial ICAM2. Furthermore, it appears to modulate DC-induced T-cell proliferation through its binding to ICAM3 on T-cells within the immunological synapse formed between DCs and T-cells[1][2].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Rhesus Macaque DC-SIGN at 2 μg/mL can bind gp120. The ED50 for this effect is 1.092 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Recombinant Rhesus Macaque DC-SIGN at 2 μg/mL canbind gp120. The ED50 for this effect is 1.092 μg/mL
Species

Rhesus Macaque

Source

HEK293

Tag

N-6*His

Accession

AAK74185.1 (K62-E381)

Gene ID
Molecular Construction
N-term
His
CD209 (K62-E381)
Accession # AAK74185.1
C-term
Synonyms
CD209 antigen; DC-SIGN1; CD209
AA Sequence

KVPSSLSQGQSKQDAIYQNLTQLKVAVSELSEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYEELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKQQEIYQELSRLKAAVGDLPEKSKQQEIYQKLTQLKAAVDGLPDRSKQQEIYQELIQLKAAVERLCRPCPWEWTFFQGNCYFMSNSQRNWHNSITACQEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNHEGTWQWVDGSPLLPSFKQYWNKGEPNNIGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSGDEERLLSPAPTTPNPPPE

Molecular Weight

Approximately 44 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DC-SIGN/CD209 Protein, Rhesus Macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DC-SIGN/CD209 Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P74205
Quantity:
MCE Japan Authorized Agent: