1. Recombinant Proteins
  2. Others
  3. CDR2 Protein, Human (His)

CDR2 Protein, Human (His)

Cat. No.: HY-P72127
Handling Instructions

CDR2 protein is a member of the CDR2 family. Although the description in the provided reference paragraph is limited, the CDR2 protein is primarily associated with paraneoplastic neurological diseases, specifically one called paraneoplastic cerebellar degeneration (PCD). CDR2 Protein, Human (His) is the recombinant human-derived CDR2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of CDR2 Protein, Human (His) is 454 a.a., with molecular weight of ~55.9 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CDR2 protein is a member of the CDR2 family. Although the description in the provided reference paragraph is limited, the CDR2 protein is primarily associated with paraneoplastic neurological diseases, specifically one called paraneoplastic cerebellar degeneration (PCD). CDR2 Protein, Human (His) is the recombinant human-derived CDR2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of CDR2 Protein, Human (His) is 454 a.a., with molecular weight of ~55.9 kDa.

Background

CDR2 Protein is a member of the CDR2 family. CDR2 Protein is primarily associated with paraneoplastic neurological disorders, particularly a condition known as paraneoplastic cerebellar degeneration (PCD). In patients with PCD, the immune system mistakenly targets and attacks the cerebellum, leading to the loss of cerebellar function. CDR2 Protein is thought to be an autoantigen in this process, meaning it triggers an autoimmune response.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q01850 (M1-S454)

Gene ID
Molecular Construction
N-term
6*His
CDR2 (M1-S454)
Accession # Q01850
C-term
Synonyms
AA617262; CDR 2; CDR 62; CDR2; CDR2_HUMAN; CDR62; Cerebellar degeneration related protein 2 62kDa; Cerebellar degeneration related protein 2; Cerebellar degeneration related protein; Cerebellar degeneration-related protein 2; Major Yo paraneoplastic antigen; MGC116181; MGC144810; MGC144811; Paraneoplastic cerebellar degeneration associated antigen; Paraneoplastic cerebellar degeneration-associated antigen; PCD 17; PCD17; RGD1310578; Yo; Yo paraneoplastic antigen
AA Sequence

MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS

Molecular Weight

Approximately 55.9 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CDR2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CDR2 Protein, Human (His)
Cat. No.:
HY-P72127
Quantity:
MCE Japan Authorized Agent: