CLEC-1/CLEC1A Protein, Mouse (HEK293, hFc)

CLEC-1/CLEC1A proteins belong to the CTL/CTLD superfamily and are known for their diverse functions in cell adhesion, signaling, glycoprotein turnover, inflammation, and immune responses. It is involved in potentially regulating dendritic cell function. CLEC-1/CLEC1A Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived CLEC-1/CLEC1A protein, expressed by HEK293 , with N-hFc labeled tag.

The C-type lectin-like domain-containing protein 1 (CLEC1A) is a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily, known for its diverse functions, including cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. This protein is implicated in the potential regulation of dendritic cell function. Situated on chromosome 12p13 in the natural killer gene complex region, CLEC1A is closely linked to other members of the CTL/CTLD superfamily. Alternative splicing gives rise to multiple transcript variants, contributing to the functional diversity of this gene. With biased expression observed in placenta (RPKM 18.1), lung (RPKM 3.8), and 10 other tissues, CLEC1A underscores its potential role in various physiological contexts.

Measured by its ability to bind fluorescein-conjugated E.coli Bioparticles. The ED₅₀ for this effect is 2.703 μg/mL, corresponding to a specific activity is 3.70×10² units/mg.

Mouse

HEK293

N-hFc

Q8BWY2 (Q73-Q269)

243653  [NCBI]

QFYQLSNIQQDSITEKDEKLGNMSRQLQSLQAQNRKLIETLQQVAVKLCRELYNKSGGHRCSPCPEKWKWYGDKCYQFYKESKNWQSCEYFCLADNATMLKISTQEELDFAMPQSYSEFFYSYWTGLSRNGSGKAWLWTDGTPYSFELFEIIIDPTNLRNRDCMTIFNGKAYSKDCKELRRCACERIAGRVVPGELQ

Approximately 58-80 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.