CRABP2 Protein, Mouse (His)

CRABP2 is an important mediator that promotes intracellular retinoic acid transport and regulates its contact with nuclear retinoic acid receptors. This key role is essential for the cellular processes controlled by retinoic acid. CRABP2 Protein, Mouse (His) is the recombinant mouse-derived CRABP2 protein, expressed by E. coli , with N-His labeled tag. The total length of CRABP2 Protein, Mouse (His) is 137 a.a., with molecular weight of ~16 kDa.

CRABP2, a critical cellular mediator, plays a pivotal role in the intracellular transport of retinoic acid, facilitating its transit to the nucleus and regulating its access to nuclear retinoic acid receptors. This transport mechanism is central to the intricate cellular processes governed by retinoic acid. Additionally, CRABP2 engages in essential interactions within the cellular milieu, forming complexes with importin alpha, which contribute to its regulatory functions (By similarity). Furthermore, CRABP2 establishes crucial molecular associations with retinoid X receptor (RXR) and retinoic acid receptor alpha (RARA), highlighting its involvement in the intricate network of nuclear receptor signaling pathways. These interactions collectively underscore CRABP2's pivotal role in orchestrating retinoic acid dynamics and its downstream regulatory effects.

Mouse

E. coli

N-6*His

P22935 (P2-E138)

12904  [NCBI]

PNFSGNWKIIRSENFEEMLKALGVNMMMRKIAVAAASKPAVEIKQENDTFYIKTSTTVRTTEINFKIGEEFEEQTVDGRPCKSLVKWESGNKMVCEQRLLKGEGPKTSWSRELTNDGELILTMTADDVVCTRVYVRE

Approximately 16 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.