CRISP-1 Protein, Mouse (HEK293, His)

CRISP-1 protein plays a crucial role in promoting the functional maturation of spermatozoa during their transition from the testis to the ductus deferens. Its involvement underscores its significance in the complex regulatory network governing male reproductive physiology, emphasizing its potential impact on sperm functionality and fertility as these cells navigate through the reproductive tract. CRISP-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CRISP-1 protein, expressed by HEK293 , with C-His labeled tag. The total length of CRISP-1 Protein, Mouse (HEK293, His) is 244 a.a., with molecular weight of ~26 KDa.

CRISP-1 protein is implicated in facilitating the functional maturation of spermatozoa during their transit from the testis to the ductus deferens. This suggests a crucial role for CRISP-1 in the intricate processes associated with sperm development and maturation. As these cells navigate through the reproductive tract, CRISP-1 is thought to play a pivotal role in promoting the necessary changes that contribute to the acquisition of functional capabilities by spermatozoa. The involvement of CRISP-1 underscores its significance in the complex regulatory network governing male reproductive physiology, emphasizing its potential impact on sperm functionality and fertility.

Mouse

HEK293

C-6*His

Q03401 (Q20-H244)

11571  [NCBI]

QDSSQENRLEKLSTTKMSVQEEIVSKHNQLRRMVSPSGSDLLKMEWNYDAQVNAQQWADKCTFSHSPIELRTTNLRCGENLFMSSYLASWSSAIQGWYNEYKDLTYDVGPKQPDSVVGHYTQVVWNSTFQVACGVAECPKNPLRYYYVCHYCPVGNYQGRLYTPYTAGEPCASCPDHCEDGLCTNSCGHEDKYTNCKYLKKMLSCEHELLKKGCKATCLCEGKIH

Approximately 26 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.