CXCR2 Protein, Human (His-SUMO)

CXCR2, the receptor for interleukin-8 (IL-8), orchestrates neutrophil activation through a G-protein-mediated phosphatidylinositol-calcium second messenger system upon IL-8 binding. Exhibiting high-affinity binding to IL-8, CXCR2 also interacts with other ligands like CXCL3, GRO/MGSA, and NAP-2. The involvement of GNAI2 underscores the intricate signaling mechanisms regulating neutrophil function through CXCR2. CXCR2 Protein, Human (His-SUMO) is the recombinant human-derived CXCR2 protein, expressed by E. coli, with N-SUMO, N-6*His labeled tag. The total length of CXCR2 Protein, Human (His-SUMO) is 40 a.a., with molecular weight of 20.6 kDa.

CXCR2, the receptor for interleukin-8 (IL-8), a potent neutrophil chemotactic factor, orchestrates the activation of neutrophils upon IL-8 binding. This response is mediated through a G-protein, initiating a phosphatidylinositol-calcium second messenger system. CXCR2 exhibits high-affinity binding not only to IL-8 but also to other ligands such as CXCL3, GRO/MGSA, and NAP-2. The interaction with IL-8 and GNAI2 further highlights the intricate signaling mechanisms involved in the regulation of neutrophil function by CXCR2.

Human

E. coli

N-SUMO;N-6*His

P25025 (M1-E40)

3579  [NCBI]

MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCE

20.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of Tris-based buffer, 50% glycerol, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.