1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Chemokine & Receptors G-Protein-Coupled Receptors (GPCRs)
  4. CXC Chemokine Receptor Chemokine Receptor
  5. CXCR2
  6. CXCR2 Protein, Human (His-SUMO)

CXCR2, the receptor for interleukin-8 (IL-8), orchestrates neutrophil activation through a G-protein-mediated phosphatidylinositol-calcium second messenger system upon IL-8 binding. Exhibiting high-affinity binding to IL-8, CXCR2 also interacts with other ligands like CXCL3, GRO/MGSA, and NAP-2. The involvement of GNAI2 underscores the intricate signaling mechanisms regulating neutrophil function through CXCR2. CXCR2 Protein, Human (His-SUMO) is the recombinant human-derived CXCR2 protein, expressed by E. coli, with N-SUMO, N-6*His labeled tag. The total length of CXCR2 Protein, Human (His-SUMO) is 40 a.a., with molecular weight of 20.6 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CXCR2, the receptor for interleukin-8 (IL-8), orchestrates neutrophil activation through a G-protein-mediated phosphatidylinositol-calcium second messenger system upon IL-8 binding. Exhibiting high-affinity binding to IL-8, CXCR2 also interacts with other ligands like CXCL3, GRO/MGSA, and NAP-2. The involvement of GNAI2 underscores the intricate signaling mechanisms regulating neutrophil function through CXCR2. CXCR2 Protein, Human (His-SUMO) is the recombinant human-derived CXCR2 protein, expressed by E. coli, with N-SUMO, N-6*His labeled tag. The total length of CXCR2 Protein, Human (His-SUMO) is 40 a.a., with molecular weight of 20.6 kDa.

Background

CXCR2, the receptor for interleukin-8 (IL-8), a potent neutrophil chemotactic factor, orchestrates the activation of neutrophils upon IL-8 binding. This response is mediated through a G-protein, initiating a phosphatidylinositol-calcium second messenger system. CXCR2 exhibits high-affinity binding not only to IL-8 but also to other ligands such as CXCL3, GRO/MGSA, and NAP-2. The interaction with IL-8 and GNAI2 further highlights the intricate signaling mechanisms involved in the regulation of neutrophil function by CXCR2.

Species

Human

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

P25025 (M1-E40)

Gene ID
Molecular Construction
N-term
6*His-SUMO
CXCR2 (M1-E40)
Accession # P25025
C-term
Synonyms
C-X-C motif chemokine receptor 2; IL8RB, interleukin 8 receptor, beta; C-X-C chemokine receptor type 2; CD182; CMKAR2;
AA Sequence

MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCE

Molecular Weight

20.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of Tris-based buffer, 50% glycerol, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CXCR2 Protein, Human (His-SUMO)
Cat. No.:
HY-P700536
Quantity:
MCE Japan Authorized Agent: