DBI Protein, Mouse (P. pastoris, His)

DBI Protein, with high affinity, binds medium- and long-chain acyl-CoA esters, potentially acting as an intracellular carrier. Moreover, DBI displaces diazepam from the benzodiazepine (BZD) recognition site on the GABA type A receptor, suggesting a neuropeptide role in modulating GABA receptor action. Structurally, as a monomer, DBI underscores the importance of its individual unit in diverse molecular interactions within cellular pathways. DBI Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived DBI protein, expressed by P. pastoris, with N-6*His labeled tag. The total length of DBI Protein, Mouse (P. pastoris, His) is 86 a.a., with molecular weight of 11.9 kDa.

The DBI Protein plays a crucial role in intracellular processes by binding with high affinity to medium- and long-chain acyl-CoA esters, suggesting its potential function as an intracellular carrier for these molecules. Additionally, DBI exhibits the ability to displace diazepam from the benzodiazepine (BZD) recognition site on the GABA type A receptor. This dual functionality raises the possibility that DBI may act as a neuropeptide, modulating the action of the GABA receptor. Structurally, the protein exists as a monomer, emphasizing its individual unit's significance in executing these diverse molecular interactions within cellular pathways.

Mouse

P. pastoris

N-6*His

P31786 (S2-I87)

13167  [NCBI]

SQAEFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEKVDELKKKYGI

11.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.