1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. DBI Protein, Mouse (P. pastoris, His)

DBI Protein, with high affinity, binds medium- and long-chain acyl-CoA esters, potentially acting as an intracellular carrier. Moreover, DBI displaces diazepam from the benzodiazepine (BZD) recognition site on the GABA type A receptor, suggesting a neuropeptide role in modulating GABA receptor action. Structurally, as a monomer, DBI underscores the importance of its individual unit in diverse molecular interactions within cellular pathways. DBI Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived DBI protein, expressed by P. pastoris, with N-6*His labeled tag. The total length of DBI Protein, Mouse (P. pastoris, His) is 86 a.a., with molecular weight of 11.9 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DBI Protein, with high affinity, binds medium- and long-chain acyl-CoA esters, potentially acting as an intracellular carrier. Moreover, DBI displaces diazepam from the benzodiazepine (BZD) recognition site on the GABA type A receptor, suggesting a neuropeptide role in modulating GABA receptor action. Structurally, as a monomer, DBI underscores the importance of its individual unit in diverse molecular interactions within cellular pathways. DBI Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived DBI protein, expressed by P. pastoris, with N-6*His labeled tag. The total length of DBI Protein, Mouse (P. pastoris, His) is 86 a.a., with molecular weight of 11.9 kDa.

Background

The DBI Protein plays a crucial role in intracellular processes by binding with high affinity to medium- and long-chain acyl-CoA esters, suggesting its potential function as an intracellular carrier for these molecules. Additionally, DBI exhibits the ability to displace diazepam from the benzodiazepine (BZD) recognition site on the GABA type A receptor. This dual functionality raises the possibility that DBI may act as a neuropeptide, modulating the action of the GABA receptor. Structurally, the protein exists as a monomer, emphasizing its individual unit's significance in executing these diverse molecular interactions within cellular pathways.

Species

Mouse

Source

P. pastoris

Tag

N-6*His

Accession

P31786 (S2-I87)

Gene ID
Molecular Construction
N-term
6*His
DBI (S2-I87)
Accession # P31786
C-term
Synonyms
Dbi; diazepam binding inhibitor; EP; Acbp; ACBD1; endozepine; acyl-CoA-binding protein; diazepam binding inhibitor, splice form 1b
AA Sequence

SQAEFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEKVDELKKKYGI

Molecular Weight

11.9 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

DBI Protein, Mouse (P. pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DBI Protein, Mouse (P. pastoris, His)
Cat. No.:
HY-P700627
Quantity:
MCE Japan Authorized Agent: