DDX19A Protein, Human (His-SUMO)

The DDX19A protein is an ATP-dependent RNA helicase that plays a crucial role in unwinding single- and double-stranded DNA in the 3'-5' direction. It is actively involved in DNA replication and repair by recruiting DNA2 to aid in 5' end resection during double-strand break repair. DDX19A Protein, Human (His-SUMO) is the recombinant human-derived DDX19A protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

BLM, an ATP-dependent DNA helicase, exhibits the capability to unwind both single- and double-stranded DNA in a 3'-5' direction. It actively participates in DNA replication and repair processes, playing a vital role in 5'-end resection of DNA during double-strand break repair by unwinding DNA and recruiting DNA2, which facilitates the cleavage of 5'-ssDNA. Additionally, BLM negatively regulates sister chromatid exchange and is involved in stimulating DNA 4-way junction branch migration as well as DNA Holliday junction dissolution. This multifaceted protein binds to single-stranded DNA, forked duplex DNA, and DNA Holliday junctions. Notably, BLM is recruited to DNA replication forks by the KHDC3-OOEP scaffold, where it is retained through TRIM25 ubiquitination, thus promoting the restart of stalled replication forks.

Human

E. coli

N-6*His;N-SUMO

Q9NUU7-1 (M1-N478)

55308  [NCBI]

MATDSWALAVDEQEAAVKSMTNLQIKEEKVKADTNGIIKTSTTAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQSQSGTGKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN

Approximately 70.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.