Delta-like protein 3/DLL3 Protein, Human (HEK293, His)

Delta-like protein 3/DLL3 stands out as a key regulator of neurogenesis and cell differentiation. As an inhibitor of primary neurogenesis, DLL3 plays a crucial role in guiding neurons along specific differentiation pathways. Delta-like protein 3/DLL3 Protein, Human (HEK293, His) is the recombinant human-derived Delta-like protein 3/DLL3 protein, expressed by HEK293 , with C-6*His labeled tag.

Delta-like protein 3/DLL3 emerges as a key regulator in the intricate landscape of neurogenesis and cellular differentiation. Acting as an inhibitor of primary neurogenesis, DLL3 is believed to play a crucial role in steering neurons along specific differentiation pathways. Its involvement extends beyond neurogenesis, contributing to the formation of somite boundaries during the segmentation of the paraxial mesoderm. Notably, DLL3 exhibits the capability to bind and activate Notch-1 or other Notch receptors, underscoring its significance in orchestrating cellular processes that govern developmental pathways and cellular fate determination.

Measured by its binding ability in a functional ELISA. Immobilized DLL3 at 2 μg/mL can bind Anti-DLL3 Recombinant Antibody, the EC₅₀ is 1-15 ng/mL.

Human

HEK293

C-6*His

Q9NYJ7-1 (A27-L492)

10683  [NCBI]

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

53 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.