TFF2 Protein, Human (HEK293, His)

TFF2 Protein, a pivotal regulator in the gastrointestinal tract, inhibits gastrointestinal motility and gastric acid secretion. Its potential role as a structural component in gastric mucus is indicated, suggesting contributions to glycoprotein stabilization through interactions with carbohydrate side chains. This multifunctional role underscores TFF2's importance in preserving the integrity and homeostasis of the gastric environment. TFF2 Protein, Human (HEK293, His) is the recombinant human-derived TFF2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TFF2 Protein, Human (HEK293, His) is 106 a.a., with molecular weight of ~19.0 kDa.

TFF2 protein plays a regulatory role in the gastrointestinal tract by inhibiting both gastrointestinal motility and gastric acid secretion. Its potential involvement as a structural component in gastric mucus is suggested, wherein it might contribute to the stabilization of glycoproteins within the mucus gel through interactions with carbohydrate side chains. This multifaceted function positions TFF2 as a crucial player in maintaining the integrity and homeostasis of the gastric environment.

Human

HEK293

C-6*His

Q03403 (E24-Y129)

7032  [NCBI]

EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY

Approximately 19.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.