1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TFF2 Protein, Human (HEK293, His)

TFF2 Protein, a pivotal regulator in the gastrointestinal tract, inhibits gastrointestinal motility and gastric acid secretion. Its potential role as a structural component in gastric mucus is indicated, suggesting contributions to glycoprotein stabilization through interactions with carbohydrate side chains. This multifunctional role underscores TFF2's importance in preserving the integrity and homeostasis of the gastric environment. TFF2 Protein, Human (HEK293, His) is the recombinant human-derived TFF2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TFF2 Protein, Human (HEK293, His) is 106 a.a., with molecular weight of ~19.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TFF2 Protein, a pivotal regulator in the gastrointestinal tract, inhibits gastrointestinal motility and gastric acid secretion. Its potential role as a structural component in gastric mucus is indicated, suggesting contributions to glycoprotein stabilization through interactions with carbohydrate side chains. This multifunctional role underscores TFF2's importance in preserving the integrity and homeostasis of the gastric environment. TFF2 Protein, Human (HEK293, His) is the recombinant human-derived TFF2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TFF2 Protein, Human (HEK293, His) is 106 a.a., with molecular weight of ~19.0 kDa.

Background

TFF2 protein plays a regulatory role in the gastrointestinal tract by inhibiting both gastrointestinal motility and gastric acid secretion. Its potential involvement as a structural component in gastric mucus is suggested, wherein it might contribute to the stabilization of glycoproteins within the mucus gel through interactions with carbohydrate side chains. This multifaceted function positions TFF2 as a crucial player in maintaining the integrity and homeostasis of the gastric environment.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q03403 (E24-Y129)

Gene ID
Molecular Construction
N-term
TFF2 (E24-Y129)
Accession # Q03403
6*His
C-term
Synonyms
Trefoil Factor 2; Spasmolysin; Spasmolytic Polypeptide; SP; TFF2; SML1
AA Sequence

EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY

Molecular Weight

Approximately 19.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TFF2 Protein, Human (HEK293, His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TFF2 Protein, Human (HEK293, His)
Cat. No.:
HY-P71354
Quantity:
MCE Japan Authorized Agent: