1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. EDAR
  6. EDAR Protein, Rat (HEK293, Fc)

EDAR Protein is a typical Tumor Necrosis Factor receptor (TNFR) family member. EDAR is a receptor for EDA isoform A1. Its binding results in recruitment of the intracellular EDAR-associated death domain (EDARADD) adapter protein and simultaneous activation of NF-kappa-B and JNK signaling pathways, potentially leading to various cellular responses. Additionally, EDAR may play a role in promoting caspase-independent cell death. EDAR Protein, Rat (HEK293, Fc) is the recombinant rat-derived EDAR protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg USD 30 In-stock
10 μg USD 72 In-stock
50 μg USD 190 In-stock
100 μg USD 300 In-stock
> 100 μg   Get quote  

Get it by June 3 for select sizes. Order within 4 hrs 26 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EDAR Protein is a typical Tumor Necrosis Factor receptor (TNFR) family member. EDAR is a receptor for EDA isoform A1. Its binding results in recruitment of the intracellular EDAR-associated death domain (EDARADD) adapter protein and simultaneous activation of NF-kappa-B and JNK signaling pathways, potentially leading to various cellular responses. Additionally, EDAR may play a role in promoting caspase-independent cell death. EDAR Protein, Rat (HEK293, Fc) is the recombinant rat-derived EDAR protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Ectodysplasin-A receptor (EDAR) is a typical Tumor Necrosis Factor receptor (TNFR) family member. EDAR is a receptor specifically for EDA isoform A1, distinguishing it from EDA isoform A2. EDA-A1/EDAR binding results in recruitment of the intracellular EDAR-associated death domain (EDARADD) adapter protein and simultaneous activation of NF-kappa-B and JNK signaling pathways, potentially leading to various cellular responses. Additionally, EDAR may play a role in promoting caspase-independent cell death. The receptor forms a complex with EDARADD, and it is associated with key signaling molecules such as TRAF1, TRAF2, TRAF3, and NIK, indicating its involvement in intricate signaling cascades. Furthermore, EDAR promots tumor cell proliferation by inducing Wnt/β-catenin signaling[1].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Rat EDAR at 2 μg/mL (100 μL/well) can bind Anti-EDAR antibody, The ED50 for this effect is 408.3ng/mL .

  • Measured by its binding ability in a functional ELISA. Immobilized Rat EDAR at 2 μg/mL (100 μL/well) can bind Anti-EDAR antibody, The ED50 for this effect is 408.3ng/mL .
Species

Rat

Source

HEK293

Tag

C-hFc

Accession

D3ZGP2/NP_001178828.1 (E27-A187)

Gene ID
Molecular Construction
N-term
EDAR (E27-A187)
Accession # D3ZGP2/NP_001178828.1
hFc
C-term
Synonyms
Tumor necrosis factor receptor superfamily member EDAR; EDA-A1 receptor; EDAR
AA Sequence

EDSNCGENEYHNQTTGLCQQCPPCRPGEEPYMSCGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGVSAHSSSTSGGSTLSPFQHAHKELSSQGHLATA

Molecular Weight

Approximately 53-75 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

EDAR Protein, Rat (HEK293, Fc) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EDAR Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P75261
Quantity:
MCE Japan Authorized Agent: