EDAR Protein, Rat (HEK293, Fc)

EDAR Protein is a typical Tumor Necrosis Factor receptor (TNFR) family member. EDAR is a receptor for EDA isoform A1. Its binding results in recruitment of the intracellular EDAR-associated death domain (EDARADD) adapter protein and simultaneous activation of NF-kappa-B and JNK signaling pathways, potentially leading to various cellular responses. Additionally, EDAR may play a role in promoting caspase-independent cell death. EDAR Protein, Rat (HEK293, Fc) is the recombinant rat-derived EDAR protein, expressed by HEK293 , with C-hFc labeled tag. The total length of EDAR Protein, Rat (HEK293, Fc) is 161 a.a., with molecular weight of 53-75 kDa.

Ectodysplasin-A receptor (EDAR) is a typical Tumor Necrosis Factor receptor (TNFR) family member. EDAR is a receptor specifically for EDA isoform A1, distinguishing it from EDA isoform A2. EDA-A1/EDAR binding results in recruitment of the intracellular EDAR-associated death domain (EDARADD) adapter protein and simultaneous activation of NF-kappa-B and JNK signaling pathways, potentially leading to various cellular responses. Additionally, EDAR may play a role in promoting caspase-independent cell death. The receptor forms a complex with EDARADD, and it is associated with key signaling molecules such as TRAF1, TRAF2, TRAF3, and NIK, indicating its involvement in intricate signaling cascades. Furthermore, EDAR promots tumor cell proliferation by inducing Wnt/β-catenin signaling^[1].

Measured by its binding ability in a functional ELISA. Immobilized Rat EDAR at 2 μg/mL (100 μL/well) can bind Anti-EDAR antibody, The ED₅₀ for this effect is 408.3ng/mL .

• 
  Measured by its binding ability in a functional ELISA. Immobilized Rat EDAR at 2 μg/mL (100 μL/well) can bind Anti-EDAR antibody, The ED₅₀ for this effect is 408.3ng/mL .

Rat

HEK293

C-hFc

D3ZGP2/NP_001178828.1 (E27-A187)

365581  [NCBI]

EDSNCGENEYHNQTTGLCQQCPPCRPGEEPYMSCGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGVSAHSSSTSGGSTLSPFQHAHKELSSQGHLATA

Approximately 53-75 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.