1. Recombinant Proteins
  2. Viral Proteins
  3. Bacterial/Fungal Proteins
  4. Enterotoxin type B Protein, S. aureus (P.pastoris, His)

Enterotoxin type B Protein, S. aureus (P.pastoris, His)

Cat. No.: HY-P71808
SDS COA Handling Instructions Technical Support

Enterotoxins (SEBs) activate the host immune system by binding raw molecules to major histocompatibility complex class II and T-cell receptor (TCR) molecules. The formation of the ternary complex triggers significant activation of T lymphocytes, leading to the systemic release of pro-inflammatory cytokines. Enterotoxin type B Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Enterotoxin type B protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Enterotoxin type B Protein, S. aureus (P.pastoris, His) is 239 a.a., with molecular weight of ~30.4 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Enterotoxin type B Protein, S. aureus (P.pastoris, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Enterotoxins (SEBs) activate the host immune system by binding raw molecules to major histocompatibility complex class II and T-cell receptor (TCR) molecules. The formation of the ternary complex triggers significant activation of T lymphocytes, leading to the systemic release of pro-inflammatory cytokines. Enterotoxin type B Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Enterotoxin type B protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Enterotoxin type B Protein, S. aureus (P.pastoris, His) is 239 a.a., with molecular weight of ~30.4 kDa.

Background

Enterotoxin type B (SEB) is a staphylococcal enterotoxin known for activating the host immune system by binding as unprocessed molecules to major histocompatibility complex class II and T-cell receptor (TCR) molecules. The formation of this ternary complex leads to the activation of a substantial number of T-lymphocytes, initiating a systemic release of pro-inflammatory cytokines. Additionally, SEB is implicated in the development of staphylococcal food poisoning syndrome. SEB interacts specifically with MHC class II molecules, composed of alpha/HLA-DRA and beta/HLA-DRB1 chains, as well as with T-cell receptor beta variable 19/TRBV19. These interactions underscore its role in immune system activation and associated pathological responses.

Species

Staphylococcus aureus

Source

P. pastoris

Tag

N-6*His

Accession

P01552 (E28-K266)

Gene ID

/

Molecular Construction
N-term
6*His
SEB (E28-K266)
Accession # P01552
C-term
Synonyms
entBEnterotoxin type B; SEB
AA Sequence

ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK

Molecular Weight

Approximately 30.4 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Enterotoxin type B Protein, S. aureus (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Enterotoxin type B Protein, S. aureus (P.pastoris, His)
Cat. No.:
HY-P71808
Quantity:
MCE Japan Authorized Agent: