1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. Eotaxin/CCL11
  6. Eotaxin/CCL11 Protein, Mouse

Eotaxin/CCL11 Protein, Mouse

Cat. No.: HY-P7160
SDS COA Handling Instructions

Eotaxin/CCL11 Protein, Mouse is a potent chemoattractant for eosinophil cells and provides a new mechanism to explain tissue eosinophilia.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Eotaxin/CCL11 Protein, Mouse Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Eotaxin/CCL11 Protein, Mouse is a potent chemoattractant for eosinophil cells and provides a new mechanism to explain tissue eosinophilia.

Background

CCL11 is a small cytokine belonging to the CC chemokine family. CCL11 selectively recruits eosinophils by inducing their chemotaxis, and therefore, is implicated in allergicresponses[1]. It is produced by IFN-γ-stimulated endothelial cells and TNF-activated monocytes. CCL11 is a potent chemoattractant for eosinophils, basophils, and Th2 lymphocytes. CCL11 has a number of important biological functions in disease processes. It plays a critical role in allergic and nonallergic inflammatory reactions, such as mycobacterial and schistosomal induced granulomatosis[2].

In Vivo

In CCL11-/- BALB/c mice, methylcholanthrene (MCA) at a concentration of 100 μg can induce fibrosarcoma in 90% of mice, possibly associated with a reduction in eosinophil influx into the tumor, which directly kills MCA-induced fibrosarcoma cells[2].
       CCL11 expression is produced in the peritoneum, serum and lung and peaked after 4 h  intraperitoneal injection of 500 μg lipopolysaccharide (LPS) in 1 mL saline in murine model of sublethal endotoxemia. When eotaxin/CCL11 knockout mice are treated with LPS, there is an increase in peritoneal neutrophils, but not lung neutrophils, compared to wild-type controls. CCL11-/- mice suppresses peritoneal neutrophils associated with endotoxemia[3].

Biological Activity

1.Full biological activity determined by a chemotaxis bioassay using purified eosinophils is in a concentration range of 100-1000 ng/mL.
2.Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 for this effect is ≤2.06 ng/mL, corresponding to a specific activity is ≥4.854×105 units/mg.
3.Measured by its ability to chemoattract BaF3-CCR3 cells. The ED50 for this effect is 4.929 ng/mL, corresponding to a specific activity is 2.029×105 U/mg.

  • Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 1.804 ng/mL, corresponding to a specific activity is 5.543×105 units/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P48298 (H24-P97)

Gene ID
Molecular Construction
N-term
CCL11 (H24-P97)
Accession # P48298
C-term
Synonyms
rMuEotaxin/CCL11; C-C motif chemokine 11; Eosinophil chemotactic protein; SCYA11
AA Sequence

HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP

Molecular Weight

Approximately 8-13.28 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 ,8% trehalose or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Eotaxin/CCL11 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Eotaxin/CCL11 Protein, Mouse
Cat. No.:
HY-P7160
Quantity:
MCE Japan Authorized Agent: