Eotaxin/CCL11 Protein, Mouse

Eotaxin/CCL11 Protein, Mouse is a potent chemoattractant for eosinophil cells and provides a new mechanism to explain tissue eosinophilia.

CCL11 is a small cytokine belonging to the CC chemokine family. CCL11 selectively recruits eosinophils by inducing their chemotaxis, and therefore, is implicated in allergicresponses^[1]. It is produced by IFN-γ-stimulated endothelial cells and TNF-activated monocytes. CCL11 is a potent chemoattractant for eosinophils, basophils, and Th2 lymphocytes. CCL11 has a number of important biological functions in disease processes. It plays a critical role in allergic and nonallergic inflammatory reactions, such as mycobacterial and schistosomal induced granulomatosis^[2].

In CCL11^-/- BALB/c mice, methylcholanthrene (MCA) at a concentration of 100 μg can induce fibrosarcoma in 90% of mice, possibly associated with a reduction in eosinophil influx into the tumor, which directly kills MCA-induced fibrosarcoma cells^[2].
       CCL11 expression is produced in the peritoneum, serum and lung and peaked after 4 h  intraperitoneal injection of 500 μg lipopolysaccharide (LPS) in 1 mL saline in murine model of sublethal endotoxemia. When eotaxin/CCL11 knockout mice are treated with LPS, there is an increase in peritoneal neutrophils, but not lung neutrophils, compared to wild-type controls. CCL11^-/- mice suppresses peritoneal neutrophils associated with endotoxemia^[3].

1.Full biological activity determined by a chemotaxis bioassay using purified eosinophils is in a concentration range of 100-1000 ng/mL.
2.Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED₅₀ for this effect is ≤2.06 ng/mL, corresponding to a specific activity is ≥4.854×10⁵ units/mg.
3.Measured by its ability to chemoattract BaF3-CCR3 cells. The ED₅₀ for this effect is 4.929 ng/mL, corresponding to a specific activity is 2.029×10⁵ U/mg.

• 
  Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED₅₀ for this effect is 1.804 ng/mL, corresponding to a specific activity is 5.543×10⁵ units/mg.

Mouse

E. coli

Tag Free

P48298 (H24-P97)

20292  [NCBI]

HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP

Approximately 8-13.28 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 ,8% trehalose or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Antonio L. Teixeira, et al. Revisiting the Role of Eotaxin-1/CCL11 in Psychiatric Disorders. Front Psychiatry. 2018 Jun 14;9:241.  [Content Brief]

  [2]. Garcia-Zepeda EA, et al. Human eotaxin is a specific chemoattractant for eosinophil cells and provides a new mechanism to explain tissue eosinophilia. Nat Med. 1996 Apr;2(4):449-56.  [Content Brief]

  [3]. R Salcedo, et al. Eotaxin (CCL11) induces in vivo angiogenic responses by human CCR3+ endothelial cells. J Immunol. 2001 Jun 15;166(12):7571-8.  [Content Brief]

  [4]. Salcedo R, et al. Eotaxin (CCL11) induces in vivo angiogenic responses by human CCR3+ endothelial cells. J Immunol. 2001 Jun 15;166(12):7571-8.  [Content Brief]

  [5]. Ljubov Simson, et al. Regulation of carcinogenesis by IL-5 and CCL11: a potential role for eosinophils in tumor immune surveillance. J Immunol. 2007 Apr 1;178(7):4222-9.  [Content Brief]