FABP1/L-FABP Protein, Human (His, solution)

FABP1/L-FABP Protein is crucial for lipoprotein-mediated cholesterol uptake in hepatocytes, specifically binding cholesterol, free fatty acids, coenzyme A derivatives, and bilirubin within the cytoplasm. It may also participate in intracellular lipid transport, sharing similarities with other proteins. FABP1/L-FABP Protein, Human (His, solution) is the recombinant human-derived FABP1/L-FABP protein, expressed by E. coli , with N-6*His labeled tag. The total length of FABP1/L-FABP Protein, Human (His, solution) is 127 a.a., with molecular weight of ~15.0 kDa.

The FABP1/L-FABP protein plays a vital role in the uptake of cholesterol mediated by lipoproteins in hepatocytes. It has been shown to specifically bind cholesterol, as well as other molecules such as free fatty acids and their coenzyme A derivatives, along with bilirubin, within the cytoplasm. Additionally, there is a possibility that FABP1/L-FABP is involved in intracellular lipid transport, based on similarities with other proteins.

Human

E. coli

N-6*His

P07148 (M1-I127)

2168  [NCBI]

MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI

Approximately 16.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 0.5 M Argine, 50% Glycerol, 2 mM EDTA, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.