FGF-18 Protein, Mouse

FGF-18 Protein, Mouse is a trophic factor for mature chondrocytes and their progenitors.

Mouse Fibroblast Growth Factor-18 (FGF18) is a trophic factor for mature chondrocytes and their progenitors^[1]. FGF18 has been reported to have significant anabolic effects on cartilage. FGF18 plays a central role in skeletal growth and development. Mice lacking Fgf18 exhibit malformations in cartilage and bone, including delayed closure of the calvarial sutures, enlargement of the proliferating and hypertrophic zones in the growth plate of long bones, defects in joint development, and delays in osteogenic differentiation^[2].

1. The ED₅₀ is <0.5 μg/mL as measured by 3T3 cells, corresponding to a specific activity of >2.0 × 10³ units/mg.
2. The ED₅₀ as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of 2.0 × 10⁶ IU/mg.

Mouse

E. coli

Tag Free

O89101 (E28-G207)

14172  [NCBI]

EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQAELQKPFKYTTVTKRSRRIRPTHPG

Approximately 20.1 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS or PBS, pH 7.4, 500 mM NaCl.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Ellsworth JL, et al. Fibroblast growth factor-18 is a trophic factor for mature chondrocytes and their progenitors. Osteoarthritis Cartilage. 2002 Apr;10(4):308-20.  [Content Brief]

  [2]. Moore EE, et al. Fibroblast growth factor-18 stimulates chondrogenesis and cartilage repair in a rat model of injury-induced osteoarthritis. Osteoarthritis Cartilage. 2005 Jul;13(7):623-31.  [Content Brief]