FGF-21 Protein, Human (His)

FGF-21 Proteinas influences glucose uptake in adipocytes by inducing SLC2A1/GLUT1 expression, particularly with KLB's presence. It plays a crucial role in systemic glucose homeostasis and insulin sensitivity, interacting directly with KLB through its C-terminus and engaging with FGFR4. The protein's molecular mechanisms involve a complex interplay, emphasizing its broad impact beyond localized effects. FGF-21 Protein, Human (His) is the recombinant human-derived FGF-21 protein, expressed by E. coli , with N-6*His labeled tag.

FGF-21 protein exerts its biological influence by promoting glucose uptake in differentiated adipocytes, primarily through inducing the expression of the glucose transporter SLC2A1/GLUT1, rather than SLC2A4/GLUT4. This activity is likely contingent on the presence of KLB. Beyond its localized effects, FGF-21 plays a crucial role in the regulation of systemic glucose homeostasis and insulin sensitivity. The protein interacts directly with KLB, facilitated by its C-terminus, and also engages with FGFR4, indicating a complex interplay in its molecular mechanisms.

Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is ≤1.756 μg/mL in the presence of 1.25 μg/mL recombinant human Klotho beta. Corresponding to a specific activity is ≥569.4761 units/mg.

• 
  Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 1.756 μg/mlin the presence of 1.25 μg/ml recombinant human Klotho beta. Corresponding to a specific activity is 569.4761 units/mg.

Human

E. coli

N-6*His

AAH18404.1 (H29-S209)

26291  [NCBI]

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Approximately 23.0 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 100 mM NaCl, 2 mM EDTA, pH 9.0 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4 or PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.