FGF-21 Protein, Human

FGF-21 Protein, Human is an atypical member of the fibroblast growth factor (FGF) subfamily, acts as a metabolic regulator with pleiotropic effects.

Human Fibroblast Growth Factor 21 (FGF21) acts in an endocrine mannerand and is a metabolic regulator with pleiotropic effects. FGF21 possesses protective effects in the cardiovascular system, primarily due to metabolic effects other thanmaintaining energy homoeostasis. FGF21 is also involved inseveral processes, including reducing arteriosclerotic plaque formation in major vessels and protecting themyocardium from injuries caused by infarction, ischaemia-reperfusion, isoproterenol-induced hypertrophy anddiabetic lipotoxicity. In addition, FG2F1 induces these effects by atten-uating remodelling-related inflammation and oxidativestress and promoting myocardial energy metabolism, as well as by preventing lipid- or diabetes-induced cardiaccell apoptosis. FGF21 functions via its interaction with FGF receptors (FGFRs), with the assistance of the co-receptor β-Klotho. Structurally, the FGFRs are divided into four isoforms, FGFR1-FGFR4^[1].

The ED₅₀ is <0.5 μg/mL as measured by FGF-receptors transfected BaF3 cells, corresponding to a specific activity of > 2.0 × 10³ units/mg.

Human

E. coli

Tag Free

Q9NSA1 (H29-S209,with an N-terminal Gly)

26291  [NCBI]

GHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Approximately 19.4 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS.

<1.0 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Cao F, et al. Fibroblast growth factor 21 attenuates calcification of vascular smooth muscle cells in vitro. J Pharm Pharmacol. 2017 Dec;69(12):1802-1816.  [Content Brief]