1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-9
  6. FGF-9 Protein, Mouse (N-His)

FGF-9 is a member of mouse heparin-binding fibroblast growth factors located on the outside of cell membranes. FGF-9 is a regulator of chondrogenesis and vascularization during bone development. FGF-9 binds to fibroblast growth factor receptors (FGFRs) to activate downstream signaling pathways, such as PI3K-AKT, RAS-MAPK and protein kinase C (PKC) pathways. FGF-9 regulates embryonic development, cell proliferation, cell differentiation and cell migration. FGF-9 plays an important role in differentiation, survival of neuronal cells and growth stimulation of glial tumors. FGF-9 Protein, Mouse (N-His) is a recombinant protein with a N-His label that consisting of 208 amino acids and is produced in E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

FGF-9 is a member of mouse heparin-binding fibroblast growth factors located on the outside of cell membranes. FGF-9 is a regulator of chondrogenesis and vascularization during bone development. FGF-9 binds to fibroblast growth factor receptors (FGFRs) to activate downstream signaling pathways, such as PI3K-AKT, RAS-MAPK and protein kinase C (PKC) pathways. FGF-9 regulates embryonic development, cell proliferation, cell differentiation and cell migration. FGF-9 plays an important role in differentiation, survival of neuronal cells and growth stimulation of glial tumors. FGF-9 Protein, Mouse (N-His) is a recombinant protein with a N-His label that consisting of 208 amino acids and is produced in E. coli[1][2][3][4][5].

Background

Fibroblast growth factors are important growth factors for physiological systems, and play critical and multifunctional roles during development, tumorigenesis, neuronal systems and disease progressions. FGF-9 Protein (Mouse) involves in neuronal disorders, plays an important role for brain development and functions[1].
FGF-9 Protein (Mouse) expression is principally restricted to the splanchnic mesodermal plate (SMP) and the mesothelium during early development, then subsequently expressed by both the mesothelium and rare epithelial cells splanchnic mesodermal plate (SMP) of mice[1].
Loss of FGF-9 Protein (Mouse) in mice leads to pancreatic hypoplasia and asplenia[1].
FGF-9 Protein (Mouse) reduces TBHP-induced oxidative stress in chondrocytes and diminishes mouse osteoarthritis by activating ERK/Nrf2 signaling pathway[2].
FGF-9 Protein (Mouse) inhibits cell apoptosis and senescence by activating intracellular HO-1 and γ-GCSc in PD models, upregulated Nrf2 expression and enhanced antioxidant effects in HD striatal cells[2].
FGF-9 Protein (Mouse) attenuates sepsis-induced fulminant hepatitis in mice[3].
FGF-9 Protein (Mouse) alleviates the infltration of neutrophils into the liver, and decreased the serum levels of pro‐infammatory cytokines such as tumor necrosis factor-alpha (TNF-α) and interleukin-6 (IL-6) in Lipopolysaccharide (LPS) (HY-D1056)/D-galactosamine (D-Gal) (HY-42682) (LPS/D-Gal)-challenged mice[3].
FGF-9 Protein (Mouse) facilitates palatal growth and timely elevation by regulating cell proliferation and hyaluronic acid accumulation in mice[4].

In Vitro

FGF-9 Protein (Mouse) (50, 100 ng/mL) protects chondrocytes against apoptosis from tert-butyl hydroperoxide (TBHP) (40 μM)-induced cellular damage[2].
FGF-9 Protein (Mouse) (100 ng/mL) reduces TBHP (40 μM)-induced oxidative stress, mitochondrial dysfunction and arouses the Nrf2 signaling pathway in chondrocytes[2].

In Vivo

Loss of FGF-9 Protein (Mouse) leads to asplenia, abnormal pancreatic and gastric development, hypoplastic lungs leading to respiratory failure in mice with a functional knockout of FGF-9. Additionally, loss of FGF-9 Protein (Mouse) reduces numbers of early pancreatic progenitors and displays defects in epithelial structure and mesothelial development in mice with a functional knockout of FGF-9[1].
FGF-9 Protein (Mouse) (1 µg/kg, intraarticular injection, daily for 8 weeks) ameliorates osteoarthritis (OA) in medial meniscus instability (DMM) mice[2].
FGF-9 Protein (Mouse) (0.5 or 1.5 mg/kg, i.p., administered 1 h before and after intraperitoneal injection of LPS/D-Gal) signifcantly attenuates LPS/D-Gal-induced liver damage in mice[3].
FGF-9 Protein (Mouse)−/− mouse embryos displays defective palatal growth and palatal elevation, exhibits aberrant cell proliferation and increases cell density, impairs palatal growth and elevation due to abnormal HA accumulation and cell proliferation[4].
Loss of FGF-9 Protein (Mouse) in mouse tendon progenitors leads to impaired apophyseal, entheseal growth and enthesis mechanical properties[5].

Biological Activity

Measured in a cell proliferation assay using NIH/3T3 mouse fibroblast cells in the presence of 10 µg/mL of heparin. The ED50 is 0.4023 ng /mL.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P54130 (A2-S208)

Gene ID
Molecular Construction
N-term
6*His
FGF-9 (A2-S208)
Accession # P54130
C-term
Synonyms
rMuFGF-9; FGF9; GAF; HBGF-9
AA Sequence

APLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Molecular Weight

Approximately 27.91 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 8.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

FGF-9 Protein, Mouse (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-9 Protein, Mouse (N-His)
Cat. No.:
HY-P7352A
Quantity:
MCE Japan Authorized Agent: