GM-CSF Protein, Rat (HEK293, His)

GM-CSF Protein, a cytokine, promotes the growth and differentiation of hematopoietic precursor cells, including granulocytes, macrophages, eosinophils, and erythrocytes. It functions as a monomer, interacting with the GM-CSF receptor complex, forming a dodecamer structure with two alpha, two beta, and two ligand subunits in head-to-head hexamers (By similarity). GM-CSF Protein, Rat (HEK293, His) is the recombinant rat-derived GM-CSF protein, expressed by HEK293 , with C-6*His labeled tag.

GM-CSF Protein is a cytokine known for its ability to promote the growth and differentiation of hematopoietic precursor cells from multiple lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. It functions as a monomer and interacts with the GM-CSF receptor complex, which consists of two head-to-head hexamers of two alpha, two beta, and two ligand subunits, forming a dodecamer structure (By similarity).

Rat

HEK293

C-6*His

P48750 (A18-K144)

116630  [NCBI]

APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK

17-25 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.