1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. GM-CSF
  5. GM-CSF Protein, Rat (HEK293, His)

GM-CSF Protein, a cytokine, promotes the growth and differentiation of hematopoietic precursor cells, including granulocytes, macrophages, eosinophils, and erythrocytes. It functions as a monomer, interacting with the GM-CSF receptor complex, forming a dodecamer structure with two alpha, two beta, and two ligand subunits in head-to-head hexamers (By similarity). GM-CSF Protein, Rat (HEK293, His) is the recombinant rat-derived GM-CSF protein, expressed by HEK293 , with C-6*His labeled tag. The total length of GM-CSF Protein, Rat (HEK293, His) is 127 a.a., with molecular weight of 17-25 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GM-CSF Protein, a cytokine, promotes the growth and differentiation of hematopoietic precursor cells, including granulocytes, macrophages, eosinophils, and erythrocytes. It functions as a monomer, interacting with the GM-CSF receptor complex, forming a dodecamer structure with two alpha, two beta, and two ligand subunits in head-to-head hexamers (By similarity). GM-CSF Protein, Rat (HEK293, His) is the recombinant rat-derived GM-CSF protein, expressed by HEK293 , with C-6*His labeled tag. The total length of GM-CSF Protein, Rat (HEK293, His) is 127 a.a., with molecular weight of 17-25 kDa.

Background

GM-CSF Protein is a cytokine known for its ability to promote the growth and differentiation of hematopoietic precursor cells from multiple lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. It functions as a monomer and interacts with the GM-CSF receptor complex, which consists of two head-to-head hexamers of two alpha, two beta, and two ligand subunits, forming a dodecamer structure (By similarity).

Species

Rat

Source

HEK293

Tag

C-6*His

Accession

P48750 (A18-K144)

Gene ID
Molecular Construction
N-term
GM-CSF (A18-K144)
Accession # P48750
6*His
C-term
Synonyms
Granulocyte-Macrophage Colony-Stimulating Factor; GM-CSF; CSF; CSF2; GMCSF
AA Sequence

APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK

Molecular Weight

17-25 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GM-CSF Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GM-CSF Protein, Rat (HEK293, His)
Cat. No.:
HY-P72629
Quantity:
MCE Japan Authorized Agent: