GMP TPO/Thrombopoietin Protein, Human (HEK293, His)

TPO/Thrombopoietin Protein, a lineage-specific cytokine, significantly influences megakaryocyte proliferation and maturation, particularly in late developmental stages from committed progenitor cells. It emerges as a potential major physiological regulator, underscoring its crucial role in the intricate orchestration of circulating platelets and emphasizing its importance in megakaryocyte biology and platelet formation. GMP TPO/Thrombopoietin Protein, Human (HEK293, His) is the recombinant human-derived TPO/Thrombopoietin protein, expressed by HEK293 , with C-6*His labeled tag. The total length of GMP TPO/Thrombopoietin Protein, Human (HEK293, His) is 332 a.a., with molecular weight of 70-90 kDa.

Thrombopoietin (TPO), a lineage-specific cytokine, exerts a pivotal influence on the proliferation and maturation of megakaryocytes, particularly at the late stages of their development from committed progenitor cells. Notably, TPO emerges as a potential major physiological regulator in the intricate orchestration of circulating platelets, underscoring its crucial role in megakaryocyte biology and platelet formation.

Measured by Mo7e human giant cell leukemia cell proliferation method, the specific activity should be great than 1×10^5 IU/mg.

Human

HEK293

N-6*His;C-6*His

P40225 (S22-G353)

7066  [NCBI]

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

70-90 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0.

<0.1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.