GPIHBP1 Protein, Human (HEK293, Fc)

GPIHBP1 Protein mediates lipid metabolism by transporting lipoprotein lipase LPL, anchoring it in capillaries, and safeguarding against loss of activity. It crucially contributes to chylomicron lipolysis, triglyceride metabolism, and overall lipid homeostasis. The protein binds chylomicrons, APOA5-containing phospholipid particles, and HDL, highlighting its role in lipid interactions and uptake. With predominantly monomeric states and 1:1 stoichiometry in LPL interaction, GPIHBP1 precisely orchestrates lipid processing, emphasizing its significance in vascular lipid transport. GPIHBP1 Protein, Human (HEK293, Fc) is the recombinant human-derived GPIHBP1 protein, expressed by HEK293, with C-hFc labeled tag. The total length of GPIHBP1 Protein, Human (HEK293, Fc) is 130 a.a., with molecular weight of 50-65 kDa.

GPIHBP1 Protein serves as a pivotal mediator in lipid metabolism by facilitating the transport of lipoprotein lipase LPL from the basolateral to the apical surface of endothelial cells in capillaries and anchoring LPL on the endothelial cell surface within the blood capillary lumen. In this capacity, GPIHBP1 protects LPL against loss of activity and ANGPTL4-mediated unfolding, playing a crucial role in the lipolytic processing of chylomicrons by LPL, triglyceride metabolism, and overall lipid homeostasis. The protein exhibits the ability to bind chylomicrons and phospholipid particles containing APOA5, contributing to its role in lipoprotein interactions. Furthermore, GPIHBP1 binds high-density lipoprotein (HDL), suggesting a role in the uptake of lipids from HDL. The protein exhibits a predominantly monomeric state but can also form homodimers and homooligomers. Its interaction with LPL occurs with a 1:1 stoichiometry, underlining the precision of its involvement in lipid processing. GPIHBP1's intricate network of interactions, including those with HDL and APOA5, emphasizes its significance in orchestrating lipid transport and maintaining lipid homeostasis within the vasculature.

Human

HEK293

C-hFc

Q8IV16 (T22-G151)

338328  [NCBI]

TQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPTG

50-65 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.