1. Recombinant Proteins
  2. Others
  3. GPIHBP1 Protein, Human (HEK293, Fc)

The GPIHBP1 protein mediates lipid metabolism by transporting lipoprotein lipase LPL, anchoring it in capillaries, and preventing loss of activity. It has a crucial role in chylomicron lipolysis, triglyceride metabolism, and overall lipid homeostasis. GPIHBP1 Protein, Human (HEK293, Fc) is the recombinant human-derived GPIHBP1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg USD 100 In-stock
50 μg USD 300 In-stock
100 μg   Get quote  

Get it by June 2 for select sizes. Order within 0 hrs 27 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GPIHBP1 protein mediates lipid metabolism by transporting lipoprotein lipase LPL, anchoring it in capillaries, and preventing loss of activity. It has a crucial role in chylomicron lipolysis, triglyceride metabolism, and overall lipid homeostasis. GPIHBP1 Protein, Human (HEK293, Fc) is the recombinant human-derived GPIHBP1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

GPIHBP1 Protein serves as a pivotal mediator in lipid metabolism by facilitating the transport of lipoprotein lipase LPL from the basolateral to the apical surface of endothelial cells in capillaries and anchoring LPL on the endothelial cell surface within the blood capillary lumen. In this capacity, GPIHBP1 protects LPL against loss of activity and ANGPTL4-mediated unfolding, playing a crucial role in the lipolytic processing of chylomicrons by LPL, triglyceride metabolism, and overall lipid homeostasis. The protein exhibits the ability to bind chylomicrons and phospholipid particles containing APOA5, contributing to its role in lipoprotein interactions. Furthermore, GPIHBP1 binds high-density lipoprotein (HDL), suggesting a role in the uptake of lipids from HDL. The protein exhibits a predominantly monomeric state but can also form homodimers and homooligomers. Its interaction with LPL occurs with a 1:1 stoichiometry, underlining the precision of its involvement in lipid processing. GPIHBP1's intricate network of interactions, including those with HDL and APOA5, emphasizes its significance in orchestrating lipid transport and maintaining lipid homeostasis within the vasculature.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q8IV16 (T22-G151)

Gene ID
Molecular Construction
N-term
GPIHBP1 (T22-G151)
Accession # Q8IV16
hFc
C-term
Synonyms
glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein1; GPI anchored high density lipoprotein binding protein 1; GPI-Anchored HDL-Binding Protein 1; GPIHBP1; GPI-HBP1; GPI-HBP1LOC338328; HBP1; High density lipoprotein-binding protein 1; H
AA Sequence

TQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPTG

Molecular Weight

50-65 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GPIHBP1 Protein, Human (HEK293, Fc) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GPIHBP1 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P70873
Quantity:
MCE Japan Authorized Agent: