1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-beta
  5. IFN-beta Protein, Human (CHO)

IFN-β (interferon-β) is a key type I interferon cytokine that coordinates the innate immune response to infection, tumors, and inflammation. IFN-β binds to high-affinity (IFNAR2) and low-affinity (IFNAR1) heterodimeric receptors, activates Jak-STAT signaling, and modulates interferon-regulated genes. IFN-beta Protein, Human (CHO) is the recombinant human-derived IFN-beta protein, expressed by CHO , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg Get quote
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFN-β (interferon-β) is a key type I interferon cytokine that coordinates the innate immune response to infection, tumors, and inflammation. IFN-β binds to high-affinity (IFNAR2) and low-affinity (IFNAR1) heterodimeric receptors, activates Jak-STAT signaling, and modulates interferon-regulated genes. IFN-beta Protein, Human (CHO) is the recombinant human-derived IFN-beta protein, expressed by CHO , with tag free.

Background

IFN-beta (Interferon-beta), a pivotal type I interferon cytokine, assumes a critical role in orchestrating the innate immune response to various challenges, including infections, tumor development, and inflammatory stimuli. Acting through a high-affinity (IFNAR2) and low-affinity (IFNAR1) heterodimeric receptor, IFN-beta triggers the canonical Jak-STAT signaling pathway, leading to the transcriptional activation or repression of interferon-regulated genes. These genes, in turn, encode effectors crucial for the interferon response, encompassing antiviral proteins, regulators of cell proliferation and differentiation, and immunoregulatory proteins. While primarily signaling through the IFNAR1-IFNAR2 heterodimeric receptor, IFN-beta also demonstrates versatility by functioning with IFNAR1 alone and operating independently of Jak-STAT pathways. Its multifaceted effects span antiviral and antibacterial activities, modulation of B-cell development, myelopoiesis, and lipopolysaccharide-inducible production of tumor necrosis factor. In the realm of neuronal homeostasis, IFN-beta emerges as a guardian, regulating dopamine turnover and safeguarding dopaminergic neurons through the promotion of neuronal autophagy and alpha-synuclein clearance, thereby averting dopaminergic neuron loss. Notably, IFN-beta surpasses interferon-alpha (IFN-alpha) in potency, particularly in inducing apoptotic and antiproliferative pathways crucial for controlling tumor cell growth. Presenting as a monomer, IFN-beta embodies a versatile and potent player in diverse physiological responses and immune regulation.

Biological Activity

1.Measured in antiviral assays using WISH cells infected with vesicular stomatitis virus and the ED50 is 1-20 pg/mL.
2.Determined by a cytotoxicity assay using human TF-1 cells. The ED50 for this effect is <0.1 ng/mL, corresponding to a specific activity of >1 x 107 units/mg.

  • Determined by a cytotoxicity assay using human TF-1 cells. The ED50 for this effect is 0.07167 ng/mL,corresponding to a specific activity of 1.395 x 107 units/mg.
Species

Human

Source

CHO

Tag

Tag Free

Accession

P01574 (M22-N187)

Gene ID
Molecular Construction
N-term
IFN-beta (M22-N187)
Accession # P01574
C-term
Synonyms
Interferon beta; IFN-beta; IFNB1; IFB; IFNB
AA Sequence

MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

Molecular Weight

Approximately 20-23 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 10 mM NaAC, 40 mM Arg, 0.12mg/ml Met, 146mg/ml Sucrose, 0.1% PF-68, pH 4.5 or PBS, pH 7.4, 8% trehalose or 40 mM Arg, 0.12 mg/mL Met, 14.60% sucrose, 0.10% PF-68, pH 4.5, 5% Trehalose, 5% Mannitol, 0.01% Tween-80 or PBS, pH 7.4 or 10 mM NaOAc, 40 mM Arg, 0.12 mg/mL Met, 14.6% sucrose, 0.1% PF-68, pH 4.5, 5% Trehalose, 5% Mannitol, 0.01% Tween-80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IFN-beta Protein, Human (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-beta Protein, Human (CHO)
Cat. No.:
HY-P73128
Quantity:
MCE Japan Authorized Agent: