IFN-beta Protein, Rhesus Macaque (HEK293, Fc)

IFN-beta Protein is an immunomodulatory cytokine of the type 1 interferon family. IFN-beta Protein reduces joint inflammation by inhibiting the RANKL-c-Fos signaling pathway. IFN-beta Protein regulates mitochondrial fission through STAT5, PGAM5, and Drp1 to rescue neurodegeneration. IFN-beta Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived IFN-beta protein, expressed by HEK293 , with C-mFc labeled tag.

Interferon (IFN) constitutes a family of cytokines that naturally secrete immunoregulatory functions. They boost macrophages to destroy tumor cells, viruses and bacteria. There are two types of IFN: Type 1 includes IFN-α and β, and type 2 consists only of IFN-γ. IFN-beta and IFN-gamma have opposite effects, IFN-gamma promotes the inflammatory response, while IFN-beta is primarily anti-inflammatory. Exogenous IFN-beta reduces joint inflammation by inhibiting the RANKL-c-Fos signaling pathway. IFN-beta rescues neurodegeneration by regulating mitochondrial fission through STAT5, PGAM5, and Drp1^[1][2][3].

Measured in antiviral assay using WISH human amnion cells infected with vesicular stomatitisvirus (VSV). The ED₅₀ for this effect is 0.1-0.5 ng/mL.

Rhesus Macaque

HEK293

C-mFc

EHH24077.1 (M22-N187)

/

MSYNLLGFLQRSSSFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQPQQFQKEDAALTIYEMLQNIFAIFRQDLSSTGWNETIVENLLANVYHQIDHLKTILEEKLEKEDFTRGKFVSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFFFINKLTGYLRN

Approximately 46.4 kDa

Greater than 85% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.