1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-beta
  5. IFN-beta Protein, Rhesus Macaque (HEK293, Fc)

IFN-beta Protein is an immunomodulatory cytokine of the type 1 interferon family. IFN-beta Protein reduces joint inflammation by inhibiting the RANKL-c-Fos signaling pathway. IFN-beta Protein regulates mitochondrial fission through STAT5, PGAM5, and Drp1 to rescue neurodegeneration. IFN-beta Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived IFN-beta protein, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFN-beta Protein is an immunomodulatory cytokine of the type 1 interferon family. IFN-beta Protein reduces joint inflammation by inhibiting the RANKL-c-Fos signaling pathway. IFN-beta Protein regulates mitochondrial fission through STAT5, PGAM5, and Drp1 to rescue neurodegeneration. IFN-beta Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived IFN-beta protein, expressed by HEK293 , with C-mFc labeled tag.

Background

Interferon (IFN) constitutes a family of cytokines that naturally secrete immunoregulatory functions. They boost macrophages to destroy tumor cells, viruses and bacteria. There are two types of IFN: Type 1 includes IFN-α and β, and type 2 consists only of IFN-γ. IFN-beta and IFN-gamma have opposite effects, IFN-gamma promotes the inflammatory response, while IFN-beta is primarily anti-inflammatory. Exogenous IFN-beta reduces joint inflammation by inhibiting the RANKL-c-Fos signaling pathway. IFN-beta rescues neurodegeneration by regulating mitochondrial fission through STAT5, PGAM5, and Drp1[1][2][3].

Biological Activity

1. Measured in antiviral assay using WISH human amnion cells infected with vesicular stomatitisvirus (VSV). The ED50 for this effect is 0.1-0.5 ng/mL.
2. Immobilized Recombinant Human IFNAR2 at 2μg/mL (100 μL/well) can bind Recombinant Rhesus IFNB1. The ED50 for this effect is 3.471 ng/mL.

Species

Rhesus Macaque

Source

HEK293

Tag

C-mFc

Accession

EHH24077.1 (M22-N187)

Gene ID

/

Molecular Construction
N-term
IFN8 (M22-N187)
Accession # EHH24077.1
mFc
C-term
Synonyms
Interferon beta; IFN-beta; IFNB1; IFB; IFNB
AA Sequence

MSYNLLGFLQRSSSFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQPQQFQKEDAALTIYEMLQNIFAIFRQDLSSTGWNETIVENLLANVYHQIDHLKTILEEKLEKEDFTRGKFVSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFFFINKLTGYLRN

Molecular Weight

Approximately 48-56 kDa band in SDS-PAGE under reducing conditions due to the glycosylation.

Purity

Greater than 85% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IFN-beta Protein, Rhesus Macaque (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-beta Protein, Rhesus Macaque (HEK293, Fc)
Cat. No.:
HY-P73132
Quantity:
MCE Japan Authorized Agent: