IFN-beta Protein, Human (HEK293)

IFN-beta Protein, Human (HEK293) is a cytokine with immunomodulatory properties.IFN-beta Protein, Human (HEK293) can be used for the study of severe COVID-19 (coronavirus disease), it reduce viral load and improve lung pathology in a marmoset model^[3].

Interferon-beta is a cytokine with immunomodulatory properties, and has therapeutic potential for the treatment of ischemic stroke^[1]. Interferon-beta (IFN-β) suppresses the production of IFN-γ and induces IL-10, whereas the production of IL-4 is not altered^[2].

The ED₅₀ is <0.1 ng/mL as measured by TF-1 cells.

Human

HEK293

Tag Free

P01574 (M22-N187)

3456  [NCBI]

MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

Approximately 23 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Kuo PC, et al. Interferon-β Modulates Inflammatory Response in Cerebral Ischemia. J Am Heart Assoc. 2016 Jan 8;5(1).  [Content Brief]

  [2]. Sega S, et al. IFN-beta1a and IFN-beta1b have different patterns of influence on cytokines. Clin Neurol Neurosurg. 2004 Jun;106(3):255-8.  [Content Brief]

  [3]. Ivan Fan-Ngai Hung,et al.Triple Combination of Interferon beta-1b, Lopinavir-Ritonavir, and Ribavirin in the Treatment of Patients Admitted to Hospital With COVID-19: An Open-Label, Randomised, Phase 2 Trial. Lancet. 2020 May 30;395(10238):1695-1704.  [Content Brief]