1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-beta
  5. IFN-beta Protein, Mouse (HEK293)

IFN-β protein is a type I interferon that plays a key role in the innate immune response by binding to IFNAR2 and IFNAR1 receptors and activating Jak-STAT signaling. This results in transcriptional regulation of interferon-regulated genes, affecting antiviral proteins, cell proliferation regulators, and immunomodulatory proteins. IFN-beta Protein, Mouse (HEK293) is the recombinant mouse-derived IFN-beta protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFN-β protein is a type I interferon that plays a key role in the innate immune response by binding to IFNAR2 and IFNAR1 receptors and activating Jak-STAT signaling. This results in transcriptional regulation of interferon-regulated genes, affecting antiviral proteins, cell proliferation regulators, and immunomodulatory proteins. IFN-beta Protein, Mouse (HEK293) is the recombinant mouse-derived IFN-beta protein, expressed by HEK293 , with tag free.

Background

IFN-beta Protein, a type I interferon cytokine, assumes a pivotal role in the innate immune response to infections, tumors, and various inflammatory stimuli. Its signaling involves binding to the high-affinity receptor IFNAR2 and the low-affinity receptor IFNAR1, forming a heterodimeric complex and activating the canonical Jak-STAT signaling pathway. This activation results in the transcriptional modulation of interferon-regulated genes, encompassing antiviral proteins, regulators of cell proliferation and differentiation, and immunoregulatory proteins. While predominantly signaling through the IFNAR1-IFNAR2 heterodimeric receptor, IFN-beta can also function with IFNAR1 alone, operating independently of Jak-STAT pathways. IFN-beta elicits diverse responses, including antiviral and antibacterial activities, and influences B-cell development, myelopoiesis, and lipopolysaccharide (LPS)-inducible production of tumor necrosis factor. Beyond its immune functions, IFN-beta plays a crucial role in neuronal homeostasis by regulating dopamine turnover and protecting dopaminergic neurons, promoting neuronal autophagy, and facilitating alpha-synuclein clearance, thereby preventing dopaminergic neuron loss. Notably, IFN-beta demonstrates greater potency than interferon-alpha (IFN-alpha) in inducing apoptotic and antiproliferative pathways crucial for controlling tumor cell growth. It functions as a monomer in these regulatory processes.

Biological Activity

1. Measured in antiviral assays using L929 cells infected with vesicular stomatitisvirus (VSV) and the ED50 is 3-18 pg/mL.
2. Determined by a cytotoxicity assay using human TF-1 cells. The ED50 this effect is ≤0.3901 ng/mL, corresponding to a specific activity is ≥2.563×106 units/mg.
3. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse IFNAR2 at 2 μg/mL (100 μL/well) can bind Biotinylated Recombinant Mouse IFN-beta. The ED50 for this effect is 4.314 ng/mL.

  • Determined by a cytotoxicity assay using human TF-1 cells. The ED50 for this effect is 0.3901 ng/mL, corresponding to a specific activity is 2.563×106 units/mg.
Species

Mouse

Source

HEK293

Tag

Tag Free

Accession

P01575 (I22-N182)

Gene ID
Molecular Construction
N-term
IFN-beta (I22-N182)
Accession # P01575
C-term
Synonyms
Interferon beta; IFN-beta; IFNB1; IFB; IFNB
AA Sequence

INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN

Molecular Weight

Approximately 24-33 kDa due to the glycosylation.

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IFN-beta Protein, Mouse (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-beta Protein, Mouse (HEK293)
Cat. No.:
HY-P73130
Quantity:
MCE Japan Authorized Agent: