IFN-beta Protein, Mouse (HEK293)

IFN-β protein is a type I interferon that plays a key role in the innate immune response by binding to IFNAR2 and IFNAR1 receptors and activating Jak-STAT signaling. This results in transcriptional regulation of interferon-regulated genes, affecting antiviral proteins, cell proliferation regulators, and immunomodulatory proteins. IFN-beta Protein, Mouse (HEK293) is the recombinant mouse-derived IFN-beta protein, expressed by HEK293 , with tag free.

IFN-beta Protein, a type I interferon cytokine, assumes a pivotal role in the innate immune response to infections, tumors, and various inflammatory stimuli. Its signaling involves binding to the high-affinity receptor IFNAR2 and the low-affinity receptor IFNAR1, forming a heterodimeric complex and activating the canonical Jak-STAT signaling pathway. This activation results in the transcriptional modulation of interferon-regulated genes, encompassing antiviral proteins, regulators of cell proliferation and differentiation, and immunoregulatory proteins. While predominantly signaling through the IFNAR1-IFNAR2 heterodimeric receptor, IFN-beta can also function with IFNAR1 alone, operating independently of Jak-STAT pathways. IFN-beta elicits diverse responses, including antiviral and antibacterial activities, and influences B-cell development, myelopoiesis, and lipopolysaccharide (LPS)-inducible production of tumor necrosis factor. Beyond its immune functions, IFN-beta plays a crucial role in neuronal homeostasis by regulating dopamine turnover and protecting dopaminergic neurons, promoting neuronal autophagy, and facilitating alpha-synuclein clearance, thereby preventing dopaminergic neuron loss. Notably, IFN-beta demonstrates greater potency than interferon-alpha (IFN-alpha) in inducing apoptotic and antiproliferative pathways crucial for controlling tumor cell growth. It functions as a monomer in these regulatory processes.

1. Measured in antiviral assays using L929 cells infected with vesicular stomatitisvirus (VSV) and the ED₅₀ is 3-18 pg/mL.
2. Determined by a cytotoxicity assay using human TF-1 cells. The ED₅₀ this effect is ≤0.3901 ng/mL, corresponding to a specific activity is ≥2.563×10⁶ units/mg.

• 
  Determined by a cytotoxicity assay using human TF-1 cells. The ED₅₀ for this effect is 0.3901 ng/mL, corresponding to a specific activity is 2.563×10⁶ units/mg.

Mouse

HEK293

Tag Free

P01575 (I22-N182)

15977  [NCBI]

INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN

Approximately 24-33 kDa due to the glycosylation.

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.