1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-γ
  5. IFN-gamma Protein, Human (HEK293)

IFN-gamma Protein, Human (HEK293)

Cat. No.: HY-P70610
SDS COA Handling Instructions

IFN-gamma Protein is a dimeric soluble cytokine. It exerts antibacterial, antiviral and antitumor effects through JAK-STAT, mTOR, MAPK and PI3K/AKT signaling pathways. IFN-gamma Protein, Human (HEK293) is the recombinant human-derived IFN-gamma protein, expressed by HEK293 , with tag free. The total length of IFN-gamma Protein, Human (HEK293) is 143 a.a., with molecular weight of 20-25 & 16-17 kDa, respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE IFN-gamma Protein, Human (HEK293)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFN-gamma Protein is a dimeric soluble cytokine. It exerts antibacterial, antiviral and antitumor effects through JAK-STAT, mTOR, MAPK and PI3K/AKT signaling pathways. IFN-gamma Protein, Human (HEK293) is the recombinant human-derived IFN-gamma protein, expressed by HEK293 , with tag free. The total length of IFN-gamma Protein, Human (HEK293) is 143 a.a., with molecular weight of 20-25 & 16-17 kDa, respectively.

Background

IFN-gamma is a dimeric soluble cytokine that is the only member of type II interferon IFN-gamma is produced by immune cells T cells and NK cells and plays an important role in antimicrobial, antiviral and anti-tumor responses by activating effector immune cells and enhancing antigen presentation. IFN-gamma influences gene regulation by interacting with its receptor IFNGR1 through the JAK-STAT pathway, and can also trigger mTOR, MAPK, and PI3K/AKT signaling pathways. IFN-gamma plays a role in the Class I antigen presentation pathway by inducing the substitution of the catalytic proteasome subunit for the immune proteasome subunit. IFN-gamma upregulates the MHC II complex on the cell surface by promoting the expression of several key molecules such as pepsin B/CTSB, H/CTSH, and L/CTSL. IFN-gamma is involved in the regulation of hematopoietic stem cells under developmental and homeostasis conditions by influencing the development, quiescence and differentiation of hematopoietic stem cells[1][2][3][4][5].

Biological Activity

Measured by its ability to inhibit the proliferation of HT-29 human coloncancer cells.The ED50 for this effect is ≤0.4622 ng/mL, corresponding to a specific activity is ≥2.164×106 Unit/mg.

  • Measured by its ability to inhibit the proliferation of HT-29 cells. The ED50 for this effect is 0.1895 ng/mL, corresponding to a specific activity is 5.277×106 Unit/mg.
Species

Human

Source

HEK293

Tag

Tag Free

Accession

P01579 (Q24-Q166)

Gene ID
Molecular Construction
N-term
IFN-gamma (Q24-Q166)
Accession # P01579
C-term
Synonyms
Interferon Gamma; IFN-Gamma; Immune Interferon; IFNG
AA Sequence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Molecular Weight

20-25 & 16-17kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 4% Mannitol, 2% Sucrose, 0.02% Tween80, pH 7.4 or PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IFN-gamma Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-gamma Protein, Human (HEK293)
Cat. No.:
HY-P70610
Quantity:
MCE Japan Authorized Agent: