IFN-gamma Protein, Human (HEK293)

IFN-gamma Protein is a dimeric soluble cytokine. It exerts antibacterial, antiviral and antitumor effects through JAK-STAT, mTOR, MAPK and PI3K/AKT signaling pathways. IFN-gamma Protein, Human (HEK293) is the recombinant human-derived IFN-gamma protein, expressed by HEK293 , with tag free. The total length of IFN-gamma Protein, Human (HEK293) is 143 a.a., with molecular weight of 20-25 & 16-17 kDa, respectively.

IFN-gamma is a dimeric soluble cytokine that is the only member of type II interferon IFN-gamma is produced by immune cells T cells and NK cells and plays an important role in antimicrobial, antiviral and anti-tumor responses by activating effector immune cells and enhancing antigen presentation. IFN-gamma influences gene regulation by interacting with its receptor IFNGR1 through the JAK-STAT pathway, and can also trigger mTOR, MAPK, and PI3K/AKT signaling pathways. IFN-gamma plays a role in the Class I antigen presentation pathway by inducing the substitution of the catalytic proteasome subunit for the immune proteasome subunit. IFN-gamma upregulates the MHC II complex on the cell surface by promoting the expression of several key molecules such as pepsin B/CTSB, H/CTSH, and L/CTSL. IFN-gamma is involved in the regulation of hematopoietic stem cells under developmental and homeostasis conditions by influencing the development, quiescence and differentiation of hematopoietic stem cells^{[1][2][3][4][5]}.

Measured by its ability to inhibit the proliferation of HT-29 human coloncancer cells.The ED₅₀ for this effect is <0.3176 ng/mL, corresponding to a specific activity is >3.148×10⁶ Unit/mg.

• 
  Measured by its ability to inhibit the proliferation of HT-29 cells. The ED₅₀ for this effect is 0.1895 ng/mL, corresponding to a specific activity is 5.277×10⁶ Unit/mg.

Human

HEK293

Tag Free

P01579 (Q24-Q166)

3458  [NCBI]

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

20-25 & 16-17kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 4% Mannitol, 2% Sucrose, 0.02% Tween80, pH 7.4 or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.