IFN-gamma Protein, Human

IFN-gamma Protein, Human is a cytokine with potent immunomodulatory, antiviral and antitumor activities.

Human Interferon-gamma (hIFNγ) is naturally produced by CD4⁺ T helper cell type 1 (Th1) lymphocytes, CD8⁺ cytotoxic lymphocytes, natural killer (NK) cells, B cells, NKT cells, and professional antigen-presenting cells (APCs). Secretion of hIFNγ by NK cells and APCs is important in early host reactions against infection while production of hIFNγ by T lymphocytes is important in the adaptive immune response. hIFNγ shows antiviral and antitumor activity and is involved in complex interactions of cellular metabolism and differentiation^[1]. Interferon-gamma (IFN-γ) is a cytokine with potent immunomodulatory propertiy. IFN-γ activates cells via a different receptor than IFN-α and IFN-β, which accounts for the different physiological properties of the proteins^[2].

The ED₅₀ is ≤0.4952 ng/mL as measured by HT-29 cells, corresponding to a specific activity of ≥2.019 × 10⁶ units/mg.

• 
  Measured by its ability to inhibit the proliferation of HT-29 human coloncancer cells.The ED₅₀ for this effect is 0.344 ng/mL, corresponding to a specificactivity is 2.906 ×10⁶ Unit/mg.

Human

E. coli

Tag Free

P01579 (Q24-Q166)

3458  [NCBI]

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Approximately 16-18 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS or PBS, pH 7.4, 5 % trehalose and 5 % mannitol or PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80 or PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Razaghi A, et al. Review of the recombinant human interferon gamma as an immunotherapeutic: Impacts of production platforms and glycosylation. J Biotechnol. 2016 Dec 20;240:48-60.  [Content Brief]

  [2]. Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34(10):759-68.  [Content Brief]