1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-γ
  5. IFN-gamma Protein, Mouse

IFN-gamma Protein, Mouse

Cat. No.: HY-P7071
Data Sheet SDS COA Handling Instructions

IFN-gamma Protein, Mouse is a pro-inflammatory cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg USD 35 In-stock
10 μg USD 70 In-stock
50 μg USD 120 In-stock
100 μg USD 190 In-stock
> 100 μg   Get quote  

Get it December 24 by noon. Order within 18 hrs 27 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-gamma Protein, Mouse is a pro-inflammatory cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties.

Background

Interferon-gamma (IFN-γ) is a cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties. IFN-γ activates cells via a different receptor than IFN-α and IFN-β, which accounts for the different physiological properties of the proteins. Production of IFN-γ is largely restricted to activated CD4+ TH1 T cells, CD8+ T cells, and natural killer cells. One of the most important consequences of IFN-γ secretion is the activation of macrophages. In addition, IFN-γ plays a central role in inflammatory responses by activating endothelial cells, promoting TH1 cell development and cellular immune responses, and up-regulation of major histocompatability complex protein expression on antigen-presenting cells[1].

Biological Activity

1. Determined by its ability to inhibit the proliferation of murine WEHI-279 cells. The expected ED50 is < 1 ng/mL.
2. Measured by its ability to inhibit the proliferation of HT-29 human coloncancer cells. The ED50 for this effect is ≤0.7283 ng/mL, corresponding to a specific activity is ≥1.37×106 Unit/mg.
3.Measured by its binding ability in a functional ELISA. When Recombinant Mouse IFN gamma is used at 10 μg/mL, the concentration of Recombinant Mouse CD119. The ED50 for this effect is ≤150 ng/mL.

  • Measured by its ability to inhibit the proliferation of HT-29 human colon cancer cells. The ED50 for this effect is 0.1399 ng/mL, corresponding to a specific activity is 7.147×106 Unit/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P01580 (H23-C155)

Gene ID
Molecular Construction
N-term
IFN-gamma (H23-C155)
Accession # P01580
C-term
Synonyms
rMuIFN-γ; IFNG; IFN-gamma; Interferon gamma
AA Sequence

HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

Molecular Weight

Approximately 12-15 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS or 4 mM HCl or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IFN-gamma Protein, Mouse Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-gamma Protein, Mouse
Cat. No.:
HY-P7071
Quantity:
MCE Japan Authorized Agent: